PHS Protein, Human (His)

PHS protein is crucial in tetrahydrobiopterin biosynthesis and has the dual function of hindering the formation of 7-pterin and promoting quinone-BH2. It also acts as a coactivator of HNF1A-dependent transcription, affecting HNF1A dimerization and enhancing its activity. PHS Protein, Human (His) is the recombinant human-derived PHS protein, expressed by E. coli , with N-6*His labeled tag.

PHS protein plays a crucial role in tetrahydrobiopterin biosynthesis, demonstrating its involvement in essential cellular processes. It appears to exhibit a dual function, acting to hinder the formation of 7-pterins while simultaneously expediting the formation of quinonoid-BH2. Beyond its role in tetrahydrobiopterin biosynthesis, PHS serves as a coactivator for HNF1A-dependent transcription, contributing to the regulation of gene expression. Notably, PHS influences the dimerization of the homeodomain protein HNF1A, augmenting its transcriptional activity. Furthermore, it acts as a coactivator in HNF1B-dependent transcription, showcasing its versatility in modulating various transcriptional processes. These multifaceted functions underscore the significance of PHS in cellular pathways and transcriptional regulation.

Human

E. coli

N-6*His

P61457-1 (A2-T104)

5092  [NCBI]

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.