PILR-beta Protein, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag. The total length of PILR-beta Protein, Mouse (HEK293, Fc) is 165 a.a., with molecular weight of 55-60 kDa.

PILR-beta Protein, a member of paired receptors integral to immune system regulation, is posited as a cellular signaling activating receptor that forms associations with ITAM-bearing adapter molecules on the cell surface. This protein is suggested to interact with DAP12 and functions as a receptor for CD99, potentially contributing to target cell recognition by natural killer cells and participating in the activation of dendritic cells. The observed interaction with CD99 and the likely association with DAP12 underscore PILR-beta's role in cellular signaling pathways, highlighting its potential impact on immune responses and cellular recognition mechanisms.

Immobilized PILR-beta at 2 μg/mL (100 μL/well) can bind Biotinylated CD99. The ED₅₀ for this effect is 2.353 µg/mL.

• 
  Immobilized PILR-beta at 2 μg/mL (100 μL/well) can bind Biotinylated CD99 . The ED₅₀ for this effect is 2.353 µg/mL.

Mouse

HEK293

C-hFc

Q2YFS2 (G29-G193)

170741  [NCBI]

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Approximately 50-70 kDa due to the glycosylation

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.