1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. PKCE Protein, Human (His)

PKCE proteins are calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine protein kinases. PKCE Protein, Human (His) is the recombinant human-derived PKCE protein, expressed by E. coli , with C-6*His labeled tag. The total length of PKCE Protein, Human (His) is 158 a.a., with molecular weight of ~20.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PKCE proteins are calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine protein kinases. PKCE Protein, Human (His) is the recombinant human-derived PKCE protein, expressed by E. coli , with C-6*His labeled tag. The total length of PKCE Protein, Human (His) is 158 a.a., with molecular weight of ~20.0 kDa.

Background

PKCE, a calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase, plays pivotal roles in regulating diverse cellular processes associated with cytoskeletal proteins, including cell adhesion, motility, migration, and cell cycle control. In cardiac fibroblasts, PKCE mediates angiotensin-2-induced integrin beta-1 (ITGB1) activation, facilitating cell adhesion to the extracellular matrix. It phosphorylates MARCKS, leading to PTK2/FAK activation and subsequent cardiomyocyte spreading. In mesenchymal cells, PKCE governs the directional transport of ITGB1 by phosphorylating vimentin (VIM). In epithelial cells, it associates with and phosphorylates keratin-8 (KRT8), influencing desmoplakin targeting at desmosomes and regulating cell-cell contact. Additionally, PKCE phosphorylates IQGAP1, promoting epithelial cell detachment prior to migration. In various contexts, such as HGF-induced cell migration, wound healing, and cytokinesis, PKCE demonstrates its versatility in coordinating complex cellular events. It also plays crucial roles in cardiac myocytes, nerve growth factor (NGF)-induced neurite outgrowth, and immune responses. Notably, PKCE influences prostate cancer cell invasion through phosphorylation of STAT3 and participates in the LPS-induced immune response via TICAM2/TRAM activation. In differentiating erythroid progenitors, PKCE is regulated by EPO, providing protection against TNFSF10/TRAIL-mediated apoptosis. Additionally, PKCE is implicated in insulin-induced phosphorylation and activation of AKT1, as well as the modulation of AKT pathway activation in cumulus cells through NLRP5/MATER phosphorylation.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q02156 (Q580-P737)

Gene ID
Molecular Construction
N-term
PKCE (Q580-P737)
Accession # Q02156
6*His
C-term
Synonyms
Protein Kinase C Epsilon Type; nPKC-Epsilon; PRKCE; PKCE
AA Sequence

QELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

Molecular Weight

Approximately 20.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PKCE Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PKCE Protein, Human (His)
Cat. No.:
HY-P71208
Quantity:
MCE Japan Authorized Agent: