1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PLA2G2E Protein, Mouse (HEK293, His)

The PLA2G2E protein is a secreted calcium-dependent phospholipase A2 that targets extracellular phospholipids. It hydrolyzes the fatty acyl group at the sn-2 position, releasing unsaturated fatty acids, especially lysophosphatidylethanolamine. PLA2G2E Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G2E protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PLA2G2E protein is a secreted calcium-dependent phospholipase A2 that targets extracellular phospholipids. It hydrolyzes the fatty acyl group at the sn-2 position, releasing unsaturated fatty acids, especially lysophosphatidylethanolamine. PLA2G2E Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G2E protein, expressed by HEK293 , with C-His labeled tag.

Background

PLA2G2E, a secretory calcium-dependent phospholipase A2, predominantly targets extracellular phospholipids and exhibits phospholipase A2 activity by hydrolyzing the ester bond of the fatty acyl group at the sn-2 position of phospholipids. This enzymatic action results in the release of various unsaturated fatty acids, including oleoate, linoleoate, arachidonate, docosahexaenoate, and lysophosphatidylethanolamines, with a preference for lysophosphatidylethanolamines over lysophosphatidylcholines. In response to a high-fat diet, PLA2G2E hydrolyzes minor lipoprotein phospholipids, such as phosphatidylserines, phosphatidylinositols, and phosphatidylglycerols, thereby influencing lipoprotein composition and fat storage in adipose tissue and liver. Operating in an autocrine and paracrine manner, PLA2G2E contributes to lipid remodeling in cellular membranes and the generation of lipid mediators vital for pathogen clearance. Additionally, it acts as a hair follicle phospholipase A2, selectively releasing lysophosphatidylethanolamines and various unsaturated fatty acids in the skin to regulate hair follicle homeostasis. Furthermore, PLA2G2E may play a role in regulating the inflammatory response by releasing arachidonate, a precursor of prostaglandins and leukotrienes. Upon allergen exposure, it potentially participates in the allergic inflammatory response by enhancing leukotriene C4 synthesis and degranulation in mast cells.

Biological Activity

Measured by its ability to hydrolyze 80μΜ 1-Hexadecanoyl-2-(1-pyrene-decanoyl)-sn-glycero-3-phosphocholine that incubate at room temperature in kinetic mode for 3 minutes. The specific activity is 124.861 pmol/min/μg.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9QUL3 (N20-C142)

Gene ID
Molecular Construction
N-term
PLA2G2E (N20-C142)
Accession # Q9QUL3
His
C-term
Synonyms
Group IIE secretory phospholipase A2; GIIE sPLA2
AA Sequence

NLVQFGVMIERMTGKPALQYNDYGCYCGVGGSHWPVDETDWCCHAHDCCYGRLEKLGCDPKLEKYLFSITRDNIFCAGRTACQRHTCECDKRAALCFRHNLNTYNRKYAHYPNKLCTGPTPPC

Molecular Weight

Approximately 16 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 10% Glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice

Documentation

PLA2G2E Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLA2G2E Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77138
Quantity:
MCE Japan Authorized Agent: