PLGF Protein, Human (N-His)

The PLGF-2 protein is a key growth factor for angiogenesis and endothelial cell growth, crucially stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. It coordinates the angiogenic process, regulates blood vessel growth, and exhibits additional binding capabilities to NRP1/neuropilin-1 and NRP2/neuropilin-2. PLGF Protein, Human (N-His) is the recombinant human-derived PLGF protein, expressed by E. coli , with N-6*His labeled tag. The total length of PLGF Protein, Human (N-His) is 131 a.a., with molecular weight of ~17 kDa.

The PLGF-2 Protein, a growth factor with significant activity in angiogenesis and endothelial cell growth, plays a crucial role in stimulating the proliferation and migration of these cells. Through binding to the FLT1/VEGFR-1 receptor, PLGF-2 orchestrates angiogenic processes and contributes to the regulation of vascular growth. Notably, the isoform PlGF-2 exhibits additional binding capabilities, forming interactions with NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Beyond its angiogenic functions, PLGF-2 also promotes tumor growth, implicating its involvement in pathological angiogenesis associated with cancer. Structurally, PLGF-2 exists as an antiparallel homodimer linked by disulfide bonds, and it can further manifest as a heterodimer with VEGFA/VEGF. The presence of isoform PlGF-3 as both a homodimer and monomer adds to the complexity of PLGF proteins, highlighting their diverse roles in modulating vascular processes and tumorigenesis.

Measured in a cell proliferation assay using HUVEC Human umbilical vein endothelial cells. The ED₅₀ this effect is 20.22 ng/mL, corresponding to a specific activity is 4.95×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using HUVEC Human umbilical vein endothelial cells. The ED₅₀ for this effect is 20.22 ng/mL, corresponding to a specific activity is 4.95×10⁴ units/mg.

Human

E. coli

N-6*His

P49763-2 (L19-R149)

5228  [NCBI]

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

Approximately 17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.