PLXNA1 Protein, Human (His)

PLXNA1 protein serves as a co-receptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D, achieving cytoskeletal remodeling and signaling through three types of signaling proteins. PLXNA1 Protein, Human (His) is the recombinant human-derived PLXNA1 protein, expressed by E. coli , with N-His labeled tag.

PLXNA1 protein serves as a coreceptor for SEMA3A, SEMA3C, SEMA3F, and SEMA6D, playing an essential role in signaling by class 3 semaphorins and subsequent cytoskeleton remodeling. It is integral to processes such as axon guidance, invasive growth, and cell migration. In the presence of class 3 semaphorins, PLXNA1 forms a complex with a neuropilin, and this interaction modulates the affinity of the complex for specific semaphorins. The cytoplasmic domain of PLXNA1 is crucial for activating downstream signaling events within the cytoplasm. Notably, the protein interacts directly with neuropilins NRP1 and NRP2, and it also engages with FARP2, RND1, and KDR/VEGFR2. The binding of SEMA3A to PLXNA1 leads to the dissociation of FARP2, highlighting the intricate regulatory role of PLXNA1 in semaphorin-mediated cellular responses.

Human

E. coli

N-His

Q9UIW2 (L986-L1152)

5361  [NCBI]

LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL

Approximately 22.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.