PNGase F Protein, F. meningosepticum (His)

The PNGase F protein acts as an enzyme catalyst that specifically cleaves entire glycans from glycoproteins. This process depends on the replacement of the glycosylated asparagine moiety by a polypeptide chain at both its amino (R1) and carboxyl (R2) termini, as shown in Reaction 1. PNGase F Protein, F. meningosepticum (His) is the recombinant PNGase F protein, expressed by E. coli , with N-His labeled tag. The total length of PNGase F Protein, F. meningosepticum (His) is 314 a.a., with molecular weight of ~35 kDa.

PNGase F (Peptide:N-glycosidase F) is a protein with the remarkable ability to cleave an entire glycan from a glycoprotein. This enzymatic process involves the removal of the glycosylated asparagine moiety, specifically requiring that the asparagine be substituted on both its amino (R1) and carboxyl (R2) termini with a polypeptide chain. PNGase F plays a pivotal role in the analysis and manipulation of glycoproteins by facilitating the release of N-linked glycans. This enzymatic activity is crucial for various applications in the study of protein glycosylation, allowing researchers to investigate the structural and functional implications of glycan modifications on proteins (

Measured by its ability to deglycosylate ribonuclease B under denatured conditions. >50% ribonuclease B (10 μg) is deglycosylated by 2.4 ng rFmPNGase F within 60 minutes, as measured under the described conditions.

Others

E. coli

N-His

P21163 (A41-N354)

/

APADNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTTVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVIQYNKSSIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPINNQSPGNWAPDRAGWCPGMAVPTRIDVLNNSLTGSTFSYEYKFQSWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTN

Approximately 35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4, 10% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.