PR-Set7 Protein, Human

The PR-Set7 Protein methylates Lys-20 of histone H4, repressing gene transcription and aiding cell proliferation and chromatin condensation. It is expressed in multiple tissues, including the prostate (RPKM 17.6), esophagus (RPKM 16.8), and others. PR-Set7 Protein, Human is the recombinant human-derived PR-Set7 protein, expressed by E. coli , with tag free.

The PR-Set7 protein is a protein-lysine N-methyltransferase responsible for monomethylating Lys-20 of histone H4, leading to the transcriptional repression of specific genes. It plays a crucial role in cell proliferation and contributes to chromatin condensation. The protein exhibits widespread expression in various tissues, including the prostate (RPKM 17.6), esophagus (RPKM 16.8), and 25 other tissues.

Measured in a cell proliferation assay using MDA-MB-231 cells. The ED₅₀ for this effect is 26.51 ng/mL, corresponding to a specific activity is 3.772×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using MDA-MB-231 cells. The ED₅₀ for this effect is 26.51 ng/mL, corresponding to a specific activity is 3.772×10⁴ units/mg.

Human

E. coli

Tag Free

Q9NQR1-2/NP_065115 (K195-H352)

387893  [NCBI]

KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

Approximately 18 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.