Betacellulin/BTC Protein, Mouse (N-His)

Probetacellulin Protein, Mouse, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes.

Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes. BTC stimulates DNA synthesis in fibroblasts and vascular smooth muscle cells. BTC plays a role in regulating growth and/or differentiation of endocrine precursor cells of the fetal pancreas. BTC is found to convert amylase-secreting pancreatic AR42J cells into insulin-producing cells and to have a mitogenic effect in human undifferentiated pancreatic epithelial cells^[1].

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ this effect is ≤0.9548 ng/mL, corresponding to a specific activity is ≥1.047×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ this effect is 0.3911 ng/ml, corresponding to a specific activity is 2.556×10⁶ units/mg.

Mouse

E. coli

N-6*His

Q05928 (D32-Y111)

12223  [NCBI]

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY

12-16 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Li L, et al. Betacellulin improves glucose metabolism by promoting conversion of intraislet precursor cells to beta-cells in streptozotocin-treated mice. Am J Physiol Endocrinol Metab. 2003 Sep;285(3):E577-83.  [Content Brief]