1. Recombinant Proteins
  2. Viral Proteins Others
  3. Protein L1/L1R, Vaccinia virus (Sf9, His, myc)

Protein L1/L1R, Vaccinia virus (Sf9, His, myc)

Cat. No.: HY-P72301
SDS COA Handling Instructions

Protein L1/L1R is part of the entry fusion complex (EFC) composed of 11 proteins. This complex facilitates the entry of the virion core into the host cytoplasm through a two-step process: lipid mixing of viral and cellular membranes, followed by pore formation. The assembly or stability of the EFC relies on all proteins except OPG095 and OPG053. Protein L1/L1R, Vaccinia virus (Sf9, His, myc) is the recombinant Virus-derived protein L1/L1R, expressed by Sf9 insect cells , with N-His, C-Myc labeled tag. The total length of Protein L1/L1R, Vaccinia virus (Sf9, His, myc) is 182 a.a., with molecular weight of ~27 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Protein L1/L1R, Vaccinia virus (Sf9, His, myc)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Protein L1/L1R is part of the entry fusion complex (EFC) composed of 11 proteins. This complex facilitates the entry of the virion core into the host cytoplasm through a two-step process: lipid mixing of viral and cellular membranes, followed by pore formation. The assembly or stability of the EFC relies on all proteins except OPG095 and OPG053. Protein L1/L1R, Vaccinia virus (Sf9, His, myc) is the recombinant Virus-derived protein L1/L1R, expressed by Sf9 insect cells , with N-His, C-Myc labeled tag. The total length of Protein L1/L1R, Vaccinia virus (Sf9, His, myc) is 182 a.a., with molecular weight of ~27 kDa.

Background

Protein L1/L1R plays a vital role as a component of the entry fusion complex (EFC), a critical assembly of 11 proteins that facilitates the entry of the virion core into the host cytoplasm during cell infection. The EFC orchestrates this process through a two-step mechanism involving lipid mixing of the viral and cellular membranes, followed by the formation of a pore. Within the EFC, Protein L1/L1R collaborates with other proteins, namely OPG053, OPG076, OPG086, OPG094, OPG099, OPG107, OPG143, OPG104, OPG147, and OPG155. Notably, with the exception of OPG095 and OPG053, each protein within the EFC is indispensable for the assembly or stability of the complex.

Species

Virus

Source

Sf9 insect cells

Tag

N-His;C-Myc

Accession

P20540 (G2-G183)

Gene ID

/

Molecular Construction
N-term
10*His
VACV L1 (G2-G183)
Accession # P20540
C-term
Synonyms
Virion membrane protein M25
AA Sequence

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 93% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Protein L1/L1R, Vaccinia virus (Sf9, His, myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Protein L1/L1R, Vaccinia virus (Sf9, His, myc)
Cat. No.:
HY-P72301
Quantity:
MCE Japan Authorized Agent: