1. Recombinant Proteins
  2. Others
  3. PSAP/Prosaposin Protein, Rat (HEK293, His)

PSAP (or Prosaposin) has multiple functions, including ganglioside binding, protein homodimerization, and scaffolding protein binding.It is involved in processes such as GM1 transport, β-galactosidase regulation, and prostate development.PSAP/Prosaposin Protein, Rat (HEK293, His) is the recombinant rat-derived PSAP/Prosaposin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PSAP (or Prosaposin) has multiple functions, including ganglioside binding, protein homodimerization, and scaffolding protein binding.It is involved in processes such as GM1 transport, β-galactosidase regulation, and prostate development.PSAP/Prosaposin Protein, Rat (HEK293, His) is the recombinant rat-derived PSAP/Prosaposin protein, expressed by HEK293 , with C-His labeled tag.

Background

PSAP, or Prosaposin, is predicted to possess several functions, including ganglioside binding activity, protein homodimerization activity, and scaffold protein binding activity. It is anticipated to be involved in processes such as ganglioside GM1 transport to the membrane, positive regulation of beta-galactosidase activity, and prostate gland development. Predicted to act upstream of or within processes with a negative effect on gene expression, it is also expected to be involved in animal organ development, glycosylceramide metabolic processes, and protein transport. PSAP is predicted to be located in the aggresome, extracellular region, and late endosome, with activity in the extracellular space and lysosome. The human ortholog(s) of this gene have been implicated in conditions such as atypical Gaucher's disease due to saposin C deficiency, combined saposin deficiency, and late-onset Parkinson's disease. PSAP exhibits biased expression in tissues such as the spleen, brain, and nine other tissues, indicating its involvement in diverse physiological processes.

Species

Rat

Source

HEK293

Tag

C-His

Accession

NP_037145.2 (S17-N554)

Gene ID
Molecular Construction
N-term
PSAP (S17-N554)
Accession # NP_037145.2
His
C-term
Synonyms
Proactivator polypeptide; Saposin-A; PSAP; GLBA; SAP1
AA Sequence

SPVQDPKICSGGSAVVCRDVKTAVDCRAVKHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATEEEILHYLEKTCAWIHDSSLSASCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQRQLESNKIPEVDLARVVAPFMSNIPLLLYPQDRPRSQPQPKANEDVCQDCMKLVTDIQTAVRTNSSFVQGLVDHVKEDCDRLGPGVSDICKNYVDQYSEVAVQMMMHMQPKEICVMVGFCDEVKRVPMRTLVPATEAIKNILPALELTDPYEQDVIQAQNVIFCQVCQLVMRKLSELIINNATEELLIKGLSKACSLLPAPASTKCQEVLVTFGPSLLDVLMHEVNPNFLCGVISLCSANPNLVGTLEQPAAAIVSALPKEPAPPKQPEEPKQSALRAHVPPQKNGGFCEVCKKLVIYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDEFVAEYEPLLLEILVEVMDPSFVCSKIGVCPSAYKLLLGTEKCVWGPGYWCQNMETAARCNAVDHCKRHVWN

Molecular Weight

Approximately 55-75 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PSAP/Prosaposin Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PSAP/Prosaposin Protein, Rat (HEK293, His)
Cat. No.:
HY-P77160
Quantity:
MCE Japan Authorized Agent: