1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. PTGR1 Protein, Human (HEK293, His)

PTGR1 Protein, Human (HEK293, His)

Cat. No.: HY-P701217
SDS COA Handling Instructions

PTGR1 is an NAD(P)H-dependent oxidoreductase that efficiently metabolizes inflammatory eicosanoids such as prostaglandins, leukotrienes, and lipoxins.It actively catalyzes the reduction of 13,14 double bonds in various 15-oxoPGs, including 15-oxo-PGE1 and 15-oxo-PGF2-alpha.PTGR1 Protein, Human (HEK293, His) is the recombinant human-derived PTGR1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $84 In-stock
50 μg $235 In-stock
100 μg $400 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PTGR1 is an NAD(P)H-dependent oxidoreductase that efficiently metabolizes inflammatory eicosanoids such as prostaglandins, leukotrienes, and lipoxins.It actively catalyzes the reduction of 13,14 double bonds in various 15-oxoPGs, including 15-oxo-PGE1 and 15-oxo-PGF2-alpha.PTGR1 Protein, Human (HEK293, His) is the recombinant human-derived PTGR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

PTGR1 is a NAD(P)H-dependent oxidoreductase actively involved in the metabolic inactivation of both pro- and anti-inflammatory eicosanoids, including prostaglandins (PG), leukotrienes (LT), and lipoxins (LX). This enzyme exhibits high efficiency in catalyzing the reduction of the 13,14 double bond of various 15-oxoPGs, such as 15-oxo-PGE1, 15-oxo-PGE2, 15-oxo-PGF1-alpha, and 15-oxo-PGF2-alpha. Additionally, PTGR1 demonstrates lower efficiency in oxidizing the hydroxyl group at C12 of LTB4 and its derivatives, converting them into less biologically active 12-oxo-LTB4 metabolites. Furthermore, PTGR1 plays a role in the metabolic detoxification of alkenals and ketones, showing a preference for alpha,beta-unsaturated alkenals and ketones with medium-chain length, including (2E)-decenal and (3E)-3-nonen-2-one. This multifaceted enzymatic activity suggests a significant role for PTGR1 in regulating inflammatory responses and detoxifying cytotoxic lipid constituents, such as 4-hydroxy-2-nonenal, thereby contributing to cellular homeostasis.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q14914 (M1-A329)

Gene ID

22949

Molecular Construction
N-term
PTGR1 (M1-A329)
Accession # Q14914
6*His
C-term
Synonyms
DIG-1; LTB4DH; PGR1; ZADH3
AA Sequence

MVRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA

Molecular Weight

Approximately 38 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from sterile 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PTGR1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTGR1 Protein, Human (HEK293, His)
Cat. No.:
HY-P701217
Quantity:
MCE Japan Authorized Agent: