PTH1R Protein, Human (HEK293, His)

PTH1R Protein, Human (HEK 293, His) is a recombinant PTH1R protein with a His-Flag. PTH1R plays an important role in skeletal development and homeostasis^[1].

PTH1R belongs to the secretin class of G protein coupled receptors (GPCRs). PTH1R is involved in bone development and bone cell differentiation, and normally activated by parathyroid hormone (PTH) and parathyroid hormone-related peptide (PTHrP).
PTH1R that is mainly expressed in cells of the osteoblastic lineage。PTH1R regulates bone metabolism, signaling mainly through G_s and G_q/11 G-proteins.
PTH1R is a critical regulator of skeletal development and homeostasis^[1][2].

Measured by its binding ability in a functional ELISA. When Recombinant Human PTH1R is used at 2 μg/mL, the concentration of biotinylated human PTHrP that produces 50% of the optimal binding response is found to 84.57 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human PTH1R is used at 2 μg/mL, the concentration of biotinylated human PTHrP that produces 50% of the optimal binding response is found to 84.57 ng/mL.

Human

HEK293

C-6*His

Q03431 (Y23-M189)

5745  [NCBI]

YALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGM

25-35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.The protein migrates as a 25-35 kDa band under reducing SDS-PAGE due to varying glycosylation.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Bryce W Pickard, et al. Type 1 parathyroid hormone receptor (PTH1R) nuclear trafficking: association of PTH1R with importin alpha1 and beta. Endocrinology. 2006 Jul;147(7):3326-32.  [Content Brief]

  [2]. Xuekun Fu, et al. Al. Kindlin-2 regulates skeletal homeostasis by modulating PTH1R in mice. Signal Transduct Target Ther. 2020 Dec 26;5(1):297.  [Content Brief]