PTPRZ1 Protein, Human (P.pastoris, His)

The PTPRZ1 protein is an important tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. It plays a crucial role in guiding the normal differentiation of precursor cells into mature oligodendrocytes and may act as an anti-apoptotic factor. PTPRZ1 Protein, Human (P.pastoris, His) is the recombinant human-derived PTPRZ1 protein, expressed by P. pastoris , with N-His labeled tag.

PTPRZ1 protein, a pivotal protein tyrosine phosphatase, serves as a negative regulator of oligodendrocyte precursor proliferation within the embryonic spinal cord. Its essential role extends to the normal differentiation of precursor cells, guiding their transformation into mature, fully myelinating oligodendrocytes. Additionally, PTPRZ1 may act as a protective factor against apoptosis in oligodendrocytes. Beyond its involvement in oligodendrocyte function, PTPRZ1 is implicated in the establishment of contextual memory, potentially through the dephosphorylation of proteins within crucial signaling cascades. This multifaceted role underscores the significance of PTPRZ1 in the intricate processes of oligodendrocyte development and neural signaling, shedding light on its potential contributions to both cellular differentiation and memory formation.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

P. pastoris

N-His

P23471-1 (I36-Y300)

5803  [NCBI]

IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY

Approximately 35 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HCl, 0.5 M NaCl, 6%Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.