1. Recombinant Proteins
  2. Receptor Proteins
  3. RAMP3 Protein, Human (HEK293, hFc)

RAMP3 protein plays a crucial role in cardioprotection by attenuating cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. RAMP3 is multifunctional, promoting the transport of CALCRL and GPER1 to the plasma membrane and coordinating membrane-associated signaling. RAMP3 Protein, Human (HEK293, hFc) is the recombinant human-derived RAMP3 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of RAMP3 Protein, Human (HEK293, hFc) is 95 a.a., with molecular weight of 45-60 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RAMP3 protein plays a crucial role in cardioprotection by attenuating cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. RAMP3 is multifunctional, promoting the transport of CALCRL and GPER1 to the plasma membrane and coordinating membrane-associated signaling. RAMP3 Protein, Human (HEK293, hFc) is the recombinant human-derived RAMP3 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of RAMP3 Protein, Human (HEK293, hFc) is 95 a.a., with molecular weight of 45-60 kDa.

Background

RAMP3 emerges as a key participant in cardioprotection, exerting its influence by mitigating cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Functionally versatile, RAMP3 facilitates the transportation of the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane, underscoring its role in orchestrating membrane-associated signaling events. Additionally, RAMP3 serves as a receptor for adrenomedullin (AM) alongside CALCRL, forming a heterodimeric complex that engages in molecular interactions crucial for mediating the effects of AM. The intricate interplay of RAMP3 with GPER1 further highlights its involvement in diverse cellular pathways and underscores its significance in cardiovascular physiology.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

O60896 (R24-V118)

Gene ID
Molecular Construction
N-term
RAMP3 (R24-V118)
Accession # O60896
hFc
C-term
Synonyms
Receptor activity-modifying protein 3; RAMP3
AA Sequence

RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV

Molecular Weight

Approximately 45-60 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RAMP3 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RAMP3 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P74603
Quantity:
MCE Japan Authorized Agent: