RAMP3 Protein, Human (HEK293, hFc)

RAMP3 protein plays a crucial role in cardioprotection by attenuating cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. RAMP3 is multifunctional, promoting the transport of CALCRL and GPER1 to the plasma membrane and coordinating membrane-associated signaling. RAMP3 Protein, Human (HEK293, hFc) is the recombinant human-derived RAMP3 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of RAMP3 Protein, Human (HEK293, hFc) is 95 a.a., with molecular weight of 45-60 kDa.

RAMP3 emerges as a key participant in cardioprotection, exerting its influence by mitigating cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Functionally versatile, RAMP3 facilitates the transportation of the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane, underscoring its role in orchestrating membrane-associated signaling events. Additionally, RAMP3 serves as a receptor for adrenomedullin (AM) alongside CALCRL, forming a heterodimeric complex that engages in molecular interactions crucial for mediating the effects of AM. The intricate interplay of RAMP3 with GPER1 further highlights its involvement in diverse cellular pathways and underscores its significance in cardiovascular physiology.

Human

HEK293

C-hFc

O60896 (R24-V118)

10268  [NCBI]

RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV

Approximately 45-60 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.