1. Recombinant Proteins
  2. Others
  3. RCVRN Protein, Human (Baculovirus, His-Myc)

RCVRN protein, a calcium sensor, regulates phototransduction in cone and rod photoreceptor cells, enhancing cone photoreceptor light sensitivity in dark conditions. In low light, it extends RHO/rhodopsin activation in rods by inhibiting GRK1-mediated phosphorylation. RCVRN contributes to scotopic vision, improving signal transfer from rods to rod bipolar cells, enhancing vision in low light. It boosts rod photoreceptor sensitivity in dim light, aiding motion detection. Existing as a homodimer, RCVRN undergoes disulfide-linked dimerization in intense illumination and may form a Ca(2+)-dependent complex with RHO and GRK1, preventing their interaction. RCVRN Protein, Human (Baculovirus, His-Myc) is the recombinant human-derived RCVRN protein, expressed by Sf9 insect cells, with N-10*His, C-Myc labeled tag. The total length of RCVRN Protein, Human (Baculovirus, His-Myc) is 199 a.a., with molecular weight of ~27.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RCVRN protein, a calcium sensor, regulates phototransduction in cone and rod photoreceptor cells, enhancing cone photoreceptor light sensitivity in dark conditions. In low light, it extends RHO/rhodopsin activation in rods by inhibiting GRK1-mediated phosphorylation. RCVRN contributes to scotopic vision, improving signal transfer from rods to rod bipolar cells, enhancing vision in low light. It boosts rod photoreceptor sensitivity in dim light, aiding motion detection. Existing as a homodimer, RCVRN undergoes disulfide-linked dimerization in intense illumination and may form a Ca(2+)-dependent complex with RHO and GRK1, preventing their interaction. RCVRN Protein, Human (Baculovirus, His-Myc) is the recombinant human-derived RCVRN protein, expressed by Sf9 insect cells, with N-10*His, C-Myc labeled tag. The total length of RCVRN Protein, Human (Baculovirus, His-Myc) is 199 a.a., with molecular weight of ~27.0 kDa.

Background

RCVRN protein serves as a calcium sensor, intricately involved in regulating phototransduction in both cone and rod photoreceptor cells. It plays a crucial role in modulating the light sensitivity of cone photoreceptors, particularly in dark and dim conditions. In response to elevated Ca(2+) levels induced by low light, RCVRN extends the activation of RHO/rhodopsin in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. This protein contributes to scotopic vision, enhancing vision in low-light conditions by facilitating signal transfer between rod photoreceptors and rod bipolar cells. Moreover, RCVRN improves rod photoreceptor sensitivity in dim light, mediating responses that aid in the detection of changes and motion in bright light. Existing as a homodimer, RCVRN undergoes disulfide-linked dimerization, a process triggered by prolonged intense illumination. Additionally, RCVRN may form a complex with RHO and GRK1 in a Ca(2+)-dependent manner, preventing the interaction between GRK1 and RHO.

Species

Human

Source

Sf9 insect cells

Tag

N-10*His;C-Myc

Accession

P35243 (G2-A200)

Gene ID
Molecular Construction
N-term
10*His
RCVRN (G2-A200)
Accession # P35243
Myc
C-term
Synonyms
23 kDa photoreceptor cell-specific protein; Cancer associated retinopathy protein; Cancer-associated retinopathy protein; CAR; CAR protein; p26; Protein CAR; RCV1; RCVRN; RECO_HUMAN; Recoverin; S-modulin
AA Sequence

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Molecular Weight

Approximately 27.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RCVRN Protein, Human (Baculovirus, His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RCVRN Protein, Human (Baculovirus, His-Myc)
Cat. No.:
HY-P72054
Quantity:
MCE Japan Authorized Agent: