RCVRN Protein, Human (Baculovirus, His-Myc)

RCVRN protein, a calcium sensor, regulates phototransduction in cone and rod photoreceptor cells, enhancing cone photoreceptor light sensitivity in dark conditions. In low light, it extends RHO/rhodopsin activation in rods by inhibiting GRK1-mediated phosphorylation. RCVRN contributes to scotopic vision, improving signal transfer from rods to rod bipolar cells, enhancing vision in low light. It boosts rod photoreceptor sensitivity in dim light, aiding motion detection. Existing as a homodimer, RCVRN undergoes disulfide-linked dimerization in intense illumination and may form a Ca(2+)-dependent complex with RHO and GRK1, preventing their interaction. RCVRN Protein, Human (Baculovirus, His-Myc) is the recombinant human-derived RCVRN protein, expressed by Sf9 insect cells, with N-10*His, C-Myc labeled tag. The total length of RCVRN Protein, Human (Baculovirus, His-Myc) is 199 a.a., with molecular weight of ~27.0 kDa.

RCVRN protein serves as a calcium sensor, intricately involved in regulating phototransduction in both cone and rod photoreceptor cells. It plays a crucial role in modulating the light sensitivity of cone photoreceptors, particularly in dark and dim conditions. In response to elevated Ca(2+) levels induced by low light, RCVRN extends the activation of RHO/rhodopsin in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. This protein contributes to scotopic vision, enhancing vision in low-light conditions by facilitating signal transfer between rod photoreceptors and rod bipolar cells. Moreover, RCVRN improves rod photoreceptor sensitivity in dim light, mediating responses that aid in the detection of changes and motion in bright light. Existing as a homodimer, RCVRN undergoes disulfide-linked dimerization, a process triggered by prolonged intense illumination. Additionally, RCVRN may form a complex with RHO and GRK1 in a Ca(2+)-dependent manner, preventing the interaction between GRK1 and RHO.

Human

Sf9 insect cells

N-10*His;C-Myc

P35243 (G2-A200)

5957  [NCBI]

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Approximately 27.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.