REG1A Protein, Cynomolgus (HEK293, His)

REG1A Protein serves as an inhibitor of spontaneous calcium carbonate precipitation. REG1A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived REG1A protein, expressed by HEK293 , with C-His labeled tag. REG1A Protein, Cynomolgus (HEK293, His), has molecular weight of ~19 & 21 kDa, respectively.

REG1A protein appears to function as an inhibitor of spontaneous calcium carbonate precipitation.

Measured in a cell proliferation assay using SH-SY5Y cells. The ED₅₀ for this effect is 1.023 μg/mL, corresponding to a specific activity is 977.517 units/mg.

Cynomolgus

HEK293

C-His

G8F4F8 (Q23-N166)

/

QEAQTDLPQARISCPEGSNAYGSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWTGLHDPKKNRRWHWSSGSLVSYKSWDIGAPNSVNPGYCVSLTSSSGFRKWKDVPCEDKFSFVCKFKN

Approximately 17&20 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.