1. Recombinant Proteins
  2. Others
  3. REG-3 alpha/REG3A Protein, Human (HEK293, His)

REG-3 alpha/REG3A Protein, Human (HEK293, His)

Cat. No.: HY-P76002
Handling Instructions Technical Support

The REG-3 alpha/REG3A protein is a bactericidal C-type lectin that selectively targets Gram-positive bacteria by binding to the peptidoglycan carbohydrate moiety. Its antimicrobial action extends to membrane phospholipid binding, forming pores that help eliminate bacteria. REG-3 alpha/REG3A Protein, Human (HEK293, His) is the recombinant human-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag. The total length of REG-3 alpha/REG3A Protein, Human (HEK293, His) is 149 a.a., with molecular weight of ~18 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The REG-3 alpha/REG3A protein is a bactericidal C-type lectin that selectively targets Gram-positive bacteria by binding to the peptidoglycan carbohydrate moiety. Its antimicrobial action extends to membrane phospholipid binding, forming pores that help eliminate bacteria. REG-3 alpha/REG3A Protein, Human (HEK293, His) is the recombinant human-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag. The total length of REG-3 alpha/REG3A Protein, Human (HEK293, His) is 149 a.a., with molecular weight of ~18 kDa.

Background

REG-3 alpha/REG3A, a bactericidal C-type lectin, exclusively targets Gram-positive bacteria, mediating bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Its antimicrobial action extends to binding membrane phospholipids, forming hexameric membrane-permeabilizing oligomeric pores that contribute to bacterial elimination. Acting as a hormone, REG-3 alpha responds to various stimuli, including anti-inflammatory signals such as IL17A and the gut microbiome. Upon secretion by diverse cell types, REG-3 alpha activates its receptor EXTL3, initiating cell-specific signaling pathways. IL17A-induced REG-3 alpha expression in keratinocytes regulates keratinocyte proliferation and differentiation after skin injury through the activation of the EXTL3-PI3K-AKT signaling pathway. Simultaneously, REG-3 alpha inhibits skin inflammation by suppressing inflammatory cytokines like IL6 and TNF. Notably, in the pancreas, REG-3 alpha permeabilizes beta-cell membranes and stimulates their proliferation.

Biological Activity

Measured by its ability to enhance the outgrowth of SH-SY5Y cells. The ED50 of this effect is 4.456 μg/mL, corresponding to a specific activity is 224.42 units/mg.

  • Measured by its ability to enhance the outgrowth of SH-SY5Y cells. The ED50 of this effect is 4.456 μg/mL, corresponding to a specific activity is 224.42 units/mg.
Species

Human

Source

HEK293

Tag

C-His

Accession

Q06141-1 (E27-D175)

Gene ID
Molecular Construction
N-term
REG3A (E27-D175)
Accession # Q06141-1
His
C-term
Synonyms
Regenerating islet-derived protein 3-alpha; REG-3-alpha; HIP/PAP; HIP; PAP; PAP1
AA Sequence

EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

Molecular Weight

Approximately 18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

REG-3 alpha/REG3A Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
REG-3 alpha/REG3A Protein, Human (HEK293, His)
Cat. No.:
HY-P76002
Quantity:
MCE Japan Authorized Agent: