REG-3 alpha/REG3A Protein, Human (HEK293, His)

The REG-3 alpha/REG3A protein is a bactericidal C-type lectin that selectively targets Gram-positive bacteria by binding to the peptidoglycan carbohydrate moiety. Its antimicrobial action extends to membrane phospholipid binding, forming pores that help eliminate bacteria. REG-3 alpha/REG3A Protein, Human (HEK293, His) is the recombinant human-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag. The total length of REG-3 alpha/REG3A Protein, Human (HEK293, His) is 149 a.a., with molecular weight of ~18 kDa.

REG-3 alpha/REG3A, a bactericidal C-type lectin, exclusively targets Gram-positive bacteria, mediating bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Its antimicrobial action extends to binding membrane phospholipids, forming hexameric membrane-permeabilizing oligomeric pores that contribute to bacterial elimination. Acting as a hormone, REG-3 alpha responds to various stimuli, including anti-inflammatory signals such as IL17A and the gut microbiome. Upon secretion by diverse cell types, REG-3 alpha activates its receptor EXTL3, initiating cell-specific signaling pathways. IL17A-induced REG-3 alpha expression in keratinocytes regulates keratinocyte proliferation and differentiation after skin injury through the activation of the EXTL3-PI3K-AKT signaling pathway. Simultaneously, REG-3 alpha inhibits skin inflammation by suppressing inflammatory cytokines like IL6 and TNF. Notably, in the pancreas, REG-3 alpha permeabilizes beta-cell membranes and stimulates their proliferation.

Measured by its ability to enhance the outgrowth of SH-SY5Y cells. The ED₅₀ of this effect is 4.456 μg/mL, corresponding to a specific activity is 224.42 units/mg.

• 
  Measured by its ability to enhance the outgrowth of SH-SY5Y cells. The ED₅₀ of this effect is 4.456 μg/mL, corresponding to a specific activity is 224.42 units/mg.

Human

HEK293

C-His

Q06141-1 (E27-D175)

5068  [NCBI]

EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

Approximately 18 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.