1. Recombinant Proteins
  2. Others
  3. REG-3 delta/REG3D Protein, Mouse (HEK293, His)

REG-3 delta/REG3D Protein, Mouse (HEK293, His)

Cat. No.: HY-P76571
Handling Instructions Technical Support

REG3D Protein enables protein binding activity and is is involved in response to peptide hormone. REG-3 delta/REG3D Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 delta/REG3D protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of REG-3 delta/REG3D Protein, Mouse (HEK293, His) is 149 a.a., with molecular weight of ~17 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

REG3D Protein enables protein binding activity and is is involved in response to peptide hormone. REG-3 delta/REG3D Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 delta/REG3D protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of REG-3 delta/REG3D Protein, Mouse (HEK293, His) is 149 a.a., with molecular weight of ~17 kDa.

Background

REG3D enables several functions, including identical protein binding activity, oligosaccharide binding activity and peptidoglycan binding activity. REG3D is involved in several processes, including antimicrobial humoral immune response mediated by antimicrobial peptide cell wall disruption in other organism and response to peptide hormone. REG3D is active in extracellular space. REG3D Orthologous to human REG3A (regenerating family member 3 alpha) and REG3G (regenerating family member 3 gamma)[1].

Species

Mouse

Source

HEK293

Tag

C-His;C-6*His

Accession

Q9QUS9/NP_038921.2 (E27-G175)

Gene ID

30053  [NCBI]

Molecular Construction
N-term
REG3D (E27-G175)
Accession # Q9QUS9/NP_038921.2
His
C-term
Synonyms
Regenerating islet-derived 3 delta; Reg III delta; Reg3d protein
AA Sequence

EQSQKKLSSPRISCPQEAQAYGSYCYLLILEPQTWANAEIHCQKHFSGHLAFLLTYGEIIFVSSLVKNSLTTFPYIWIGLHDLSLGSLPNENGWKWSSSDPLTFYNWEIPPSMSAHHGYCAALSQASGYQKWRDYYCDTIFPYVCKFKG

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

REG-3 delta/REG3D Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
REG-3 delta/REG3D Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76571
Quantity:
MCE Japan Authorized Agent: