1. Recombinant Proteins
  2. Viral Proteins
  3. Replicase 1AB polyprotein Protein, SARS-CoV (Cell-Free, His)

Replicase 1AB polyprotein Protein, SARS-CoV (Cell-Free, His)

Cat. No.: HY-P702421
Handling Instructions Technical Support

Replicase 1AB polyprotein Protein, SARS-CoV (Cell-Free, His) is the recombinant Virus-derived Replicase 1AB polyprotein protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of Replicase 1AB polyprotein Protein, SARS-CoV (Cell-Free, His) is 290 a.a., with molecular weight of 35.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Replicase 1AB polyprotein Protein, SARS-CoV (Cell-Free, His) is the recombinant Virus-derived Replicase 1AB polyprotein protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of Replicase 1AB polyprotein Protein, SARS-CoV (Cell-Free, His) is 290 a.a., with molecular weight of 35.8 kDa.

Species

Virus

Source

E. coli Cell-free

Tag

N-10*His

Accession

C8YZ74 (G3547-Q3836)

Gene ID

/

Molecular Construction
N-term
10*His
pp1ab (G3547-Q3836)
Accession # C8YZ74
C-term
Synonyms
Growth factor-like peptide; Leader protein; Non-structural protein 10; Non-structural protein 2; Non-structural protein 3; Non-structural protein 4; Non-structural protein 6; Non-structural protein 7; Non-structural protein 8; Non-structural protein 9; Papain-like proteinase; p65 homolog
AA Sequence

GKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQ

Molecular Weight

35.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Replicase 1AB polyprotein Protein, SARS-CoV (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Replicase 1AB polyprotein Protein, SARS-CoV (Cell-Free, His)
Cat. No.:
HY-P702421
Quantity:
MCE Japan Authorized Agent: