1. Recombinant Proteins
  2. Others
  3. RKIP/PEBP1 Protein, Human

The RKIP/PEBP1 protein has diverse binding capabilities and can interact with ATP, opioids, and phosphatidylethanolamine. It acts as a serine protease inhibitor, effectively inhibiting thrombin, neuroproteases, and chymotrypsin. RKIP/PEBP1 Protein, Human is the recombinant human-derived RKIP/PEBP1 protein, expressed by E. coli , with tag free. The total length of RKIP/PEBP1 Protein, Human is 187 a.a., with molecular weight of ~21.1 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RKIP/PEBP1 protein has diverse binding capabilities and can interact with ATP, opioids, and phosphatidylethanolamine. It acts as a serine protease inhibitor, effectively inhibiting thrombin, neuroproteases, and chymotrypsin. RKIP/PEBP1 Protein, Human is the recombinant human-derived RKIP/PEBP1 protein, expressed by E. coli , with tag free. The total length of RKIP/PEBP1 Protein, Human is 187 a.a., with molecular weight of ~21.1 KDa.

Background

The RKIP/PEBP1 protein exhibits versatile binding capabilities, interacting with ATP, opioids, and phosphatidylethanolamine, while displaying lower affinity for phosphatidylinositol and phosphatidylcholine. This protein serves as a serine protease inhibitor, effectively inhibiting thrombin, neuropsin, and chymotrypsin, albeit not trypsin, tissue-type plasminogen activator, and elastase. Notably, RKIP/PEBP1 plays a pivotal role in modulating the kinase activity of RAF1 by impeding its activation, dissociating the RAF1/MEK complex, and acting as a competitive inhibitor of MEK phosphorylation. Additionally, it is implicated in the function of presynaptic cholinergic neurons in the central nervous system, enhancing the production of choline acetyltransferase without affecting acetylcholinesterase. This regulatory function appears to be mediated by a specific receptor.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P30086 (M1-K187)

Gene ID
Molecular Construction
N-term
RKIP (M1-K187)
Accession # P30086
C-term
Synonyms
Phosphatidylethanolamine-binding protein 1; HCNPpp; Neuropolypeptide h3; HCNP; PBP; PEBP
AA Sequence

MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Molecular Weight

Approximately 21.1 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RKIP/PEBP1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RKIP/PEBP1 Protein, Human
Cat. No.:
HY-P77179
Quantity:
MCE Japan Authorized Agent: