Rnase 3 Protein, Human (HEK293, His)

Rnase 3 Protein, Human (HEK293, His) is the recombinant human-derived Rnase 3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Rnase 3 Protein, Human (HEK293, His) is 133 a.a., with molecular weight of 25-35 kDa.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

AAH96060.1 (R28-I160)

6037  [NCBI]

RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

25-35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Tris HCl, 150 mM NaCl, 1 mM DTT, 10% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.