RSPO1/R-spondin-1 Protein, Mouse (189aa, His)

RSPO1 activates the canonical Wnt signaling pathway by binding to LGR4-6 receptors, triggering increased expression of target genes. It inhibits ZNRF3, regulating the Wnt signaling pathway, and negatively regulates the TGF-beta pathway. RSPO1 also plays a role in ovary determination and interacts with various proteins including FZD8, LRP6, and WNT1. It forms complexes with RNF43, LGR5, and LGR6, and promotes membrane clearance of ZNRF3. RSPO1 binds heparin and interacts with LGR4, LGR5, and LGR6. RSPO1/R-spondin-1 Protein, Mouse (189aa, His) is the recombinant mouse-derived RSPO1/R-spondin-1 protein, expressed by E. coli, with N-6*His labeled tag. The total length of RSPO1/R-spondin-1 Protein, Mouse (189aa, His) is 189 a.a., with molecular weight of ~23 kDa.

RSPO1, or R-spondin-1 protein, functions as an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6, RSPO1 associates with phosphorylated LRP6 and frizzled receptors, which are activated by extracellular Wnt receptors. This association triggers the canonical Wnt signaling pathway, leading to increased expression of target genes. RSPO1 also plays a role in regulating the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by inhibiting ZNRF3, an important regulator of the Wnt signaling pathway. Additionally, RSPO1 acts as a ligand for frizzled FZD8 and LRP6, and may negatively regulate the TGF-beta pathway. It has essential roles in ovary determination and regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. RSPO1 interacts with ZNRF3, promoting indirect interaction between ZNRF3 and LGR4 and facilitating membrane clearance of ZNRF3. It is also identified in a complex composed of RNF43, LGR5, and RSPO1. RSPO1 interacts with the extracellular domain of FZD8 and LRP6, but does not form a ternary complex with them. Additionally, RSPO1 interacts with WNT1, binds heparin, and interacts with LGR4, LGR5, and LGR6.

Measured by its ability to induce alkaline phosphatase production by MC3T3-E1. The ED₅₀ for this effect is 72.8 ng/mL, corresponding to a specific activity is 1.3736×10⁴ units/mg.

• 
  Measured by its ability to induce alkaline phosphatase production by MC3T3-E1. The ED₅₀ for this effect is 72.8 ng/mL, corresponding to a specific activity is 1.3736×10⁴ units/mg.

Mouse

E. coli

N-6*His

Q9Z132 (S21-G209)

192199  [NCBI]

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEALYLHKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFRKGSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEG

Approximately 23 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.