1. Recombinant Proteins
  2. Others
  3. S100A14 Protein, Human (His, solution)

The S100A14 protein, encoded by a gene on chromosome 1, is a member of the S100 protein family with calcium-binding ability. It shows decreased levels in cancerous tissue, suggesting a potential tumor suppressor role and association with metastasis. S100A14 exhibits biased expression in the esophagus (RPKM 798.1), skin (RPKM 171.2), and other tissues, indicating its potential significance in these contexts. S100A14 Protein, Human (His, solution) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag. The total length of S100A14 Protein, Human (His, solution) is 103 a.a., with molecular weight of ~12 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A14 protein, encoded by a gene on chromosome 1, is a member of the S100 protein family with calcium-binding ability. It shows decreased levels in cancerous tissue, suggesting a potential tumor suppressor role and association with metastasis. S100A14 exhibits biased expression in the esophagus (RPKM 798.1), skin (RPKM 171.2), and other tissues, indicating its potential significance in these contexts. S100A14 Protein, Human (His, solution) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag. The total length of S100A14 Protein, Human (His, solution) is 103 a.a., with molecular weight of ~12 kDa.

Background

The S100A14 protein, a member of the S100 protein family characterized by its EF-hand motif and calcium-binding ability, is encoded by this gene located in a cluster of S100 genes on chromosome 1. Notably, decreased levels of this protein have been observed in cancerous tissue, suggesting its potential role as a tumor suppressor and its association with metastasis (PMID: 19956863, 19351828). Additionally, expression analysis reveals biased expression of S100A14 in the esophagus (RPKM 798.1), skin (RPKM 171.2), and several other tissues, highlighting its potential significance in these contexts.

Species

Human

Source

E. coli

Tag

N-His

Accession

NP_065723.1 (G2-H104)

Gene ID

57402

Molecular Construction
N-term
His
S100A14 (G2-H104)
Accession # NP_065723.1
C-term
Synonyms
Protein S100-A14; S100 calcium-binding protein A14; S114; S100A14; S100A15
AA Sequence

GQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Molecular Weight

Approximately 12 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 20% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

S100A14 Protein, Human (His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A14 Protein, Human (His, solution)
Cat. No.:
HY-P76584A
Quantity:
MCE Japan Authorized Agent: