1. Recombinant Proteins
  2. Others
  3. S100A15A Protein, Mouse (solution)

S100A15A Protein, part of the Tyr protein kinase family within the ROR subfamily, is implicated in phosphorylation events, particularly on tyrosine residues. Its association with the Receptor Tyrosine Kinase-Like Orphan Receptor (ROR) family suggests potential roles in cellular signaling pathways, influencing processes such as cell growth and differentiation. Being in the protein kinase superfamily underscores the diversity and importance of kinase activities, emphasizing S100A15A's functional significance in various cellular processes. S100A15A Protein, Mouse (solution) is the recombinant mouse-derived S100A15A protein, expressed by E. coli, with tag free. The total length of S100A15A Protein, Mouse (solution) is 108 a.a., with molecular weight of ~12.0 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A15A Protein, part of the Tyr protein kinase family within the ROR subfamily, is implicated in phosphorylation events, particularly on tyrosine residues. Its association with the Receptor Tyrosine Kinase-Like Orphan Receptor (ROR) family suggests potential roles in cellular signaling pathways, influencing processes such as cell growth and differentiation. Being in the protein kinase superfamily underscores the diversity and importance of kinase activities, emphasizing S100A15A's functional significance in various cellular processes. S100A15A Protein, Mouse (solution) is the recombinant mouse-derived S100A15A protein, expressed by E. coli, with tag free. The total length of S100A15A Protein, Mouse (solution) is 108 a.a., with molecular weight of ~12.0 KDa.

Background

ROR1 Protein belongs to the protein kinase superfamily, specifically the Tyr protein kinase family within the ROR subfamily. As a member of this superfamily, ROR1 is characterized by its potential involvement in phosphorylation events, particularly on tyrosine residues. The designation within the ROR subfamily emphasizes its association with the Receptor Tyrosine Kinase-Like Orphan Receptor (ROR) family. This suggests that ROR1 may play a role in cellular signaling pathways, possibly influencing processes related to cell growth, differentiation, or other signaling cascades. The inclusion in the broader protein kinase superfamily underscores the diversity and importance of kinase activities in cellular regulation, highlighting ROR1's potential functional significance in various cellular processes.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q6S5I3 (M1-Y108)

Gene ID
Molecular Construction
N-term
S100A15A (M1-Y108)
Accession # Q6S5I3
C-term
Synonyms
S100 calcium-binding protein A15A; Protein S100-A15A; Protein S100-A7A; S100 calcium-binding protein A7A; S100a15a
AA Sequence

MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY

Molecular Weight

Approximately 12.0 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 30% Glycerol, 1mM DTT, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

S100A15A Protein, Mouse (solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A15A Protein, Mouse (solution)
Cat. No.:
HY-P71272A
Quantity:
MCE Japan Authorized Agent: