S100A15A Protein, Mouse

S100A15A Protein, part of the Tyr protein kinase family within the ROR subfamily, is implicated in phosphorylation events, particularly on tyrosine residues. Its association with the Receptor Tyrosine Kinase-Like Orphan Receptor (ROR) family suggests potential roles in cellular signaling pathways, influencing processes such as cell growth and differentiation. Being in the protein kinase superfamily underscores the diversity and importance of kinase activities, emphasizing S100A15A's functional significance in various cellular processes. S100A15A Protein, Mouse is the recombinant mouse-derived S100A15A protein, expressed by E. coli, with tag free. The total length of S100A15A Protein, Mouse is 108 a.a., with molecular weight of ~12.0 kDa.

ROR1 Protein belongs to the protein kinase superfamily, specifically the Tyr protein kinase family within the ROR subfamily. As a member of this superfamily, ROR1 is characterized by its potential involvement in phosphorylation events, particularly on tyrosine residues. The designation within the ROR subfamily emphasizes its association with the Receptor Tyrosine Kinase-Like Orphan Receptor (ROR) family. This suggests that ROR1 may play a role in cellular signaling pathways, possibly influencing processes related to cell growth, differentiation, or other signaling cascades. The inclusion in the broader protein kinase superfamily underscores the diversity and importance of kinase activities in cellular regulation, highlighting ROR1's potential functional significance in various cellular processes.

Mouse

E. coli

Tag Free

Q6S5I3 (M1-Y108)

381493  [NCBI]

MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY

Approximately 12.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 30% Glycerol, 1mM DTT, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.