1. Recombinant Proteins
  2. Others
  3. S100B Protein, Human (HEK293, Fc)

S100B protein is encoded by the S100B gene and is a member of the S100 family. It regulates cellular processes such as cell cycle progression and differentiation. S100B Protein, Human (HEK293, Fc) is the recombinant human-derived S100B protein, expressed by HEK293 , with N-hFc labeled tag. The total length of S100B Protein, Human (HEK293, Fc) is 91 a.a., with molecular weight of ~40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

S100B Protein, Human (HEK293, Fc) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100B protein is encoded by the S100B gene and is a member of the S100 family. It regulates cellular processes such as cell cycle progression and differentiation. S100B Protein, Human (HEK293, Fc) is the recombinant human-derived S100B protein, expressed by HEK293 , with N-hFc labeled tag. The total length of S100B Protein, Human (HEK293, Fc) is 91 a.a., with molecular weight of ~40 kDa.

Background

The S100B gene encodes a protein belonging to the S100 family, characterized by 2 EF-hand calcium-binding motifs. S100 proteins are found in the cytoplasm and/or nucleus of various cells, playing crucial roles in regulating cellular processes such as cell cycle progression and differentiation. While most S100 genes are clustered on chromosome 1q21, S100B is uniquely located at 21q22.3. This protein is implicated in neurite extension, melanoma cell proliferation, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, as well as inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of S100B are associated with various diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. Notably, its expression is biased, with significant levels observed in the brain, fat, and select other tissues.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized recombinant human S100B at 10 μg/mL (100 μl/well) can bind biotinylated human S100A1(HY-P74589). The ED50 for this effect is 150-250 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized recombinant human S100B at 10 μg/mL (100 μl/well) can bind biotinylated human S100A1. The ED50 for this effect is 153.8 ng/mL.
Species

Human

Source

HEK293

Tag

N-hFc

Accession

NP_006263.1 (S2-E92)

Gene ID
Molecular Construction
N-term
hFc
S100B (S2-E92)
Accession # NP_006263.1
C-term
Synonyms
Protein S100-B; S-100 protein beta chain; S100b; S100 beta
AA Sequence

SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Molecular Weight

Approximately 35-40 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100B Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100B Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73391
Quantity:
MCE Japan Authorized Agent: