1. Recombinant Proteins
  2. Others
  3. SAA1 Protein, Mouse (His)

Serum Amyloid A-1 Protein, a vital acute phase protein, primarily exists as a homohexamer composed of dimers of trimers.Although it can form amyloid fibrils after partial proteolysis, the native, undenatured form does not exhibit amyloid fibril formation in vitro.Serving as an apolipoprotein within the HDL complex, Serum Amyloid A-1 also shows affinity for heparin binding, highlighting its multifaceted role in biological processes.SAA1 Protein, Mouse (His) is the recombinant mouse-derived SAA1 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Serum Amyloid A-1 Protein, a vital acute phase protein, primarily exists as a homohexamer composed of dimers of trimers.Although it can form amyloid fibrils after partial proteolysis, the native, undenatured form does not exhibit amyloid fibril formation in vitro.Serving as an apolipoprotein within the HDL complex, Serum Amyloid A-1 also shows affinity for heparin binding, highlighting its multifaceted role in biological processes.SAA1 Protein, Mouse (His) is the recombinant mouse-derived SAA1 protein, expressed by E.coli , with N-6*His labeled tag.

Background

Serum Amyloid A-1 Protein emerges as a significant acute phase protein, existing primarily as a homohexamer composed of dimers of trimers. While it has the potential to form amyloid fibrils after partial proteolysis, it's noteworthy that the native, undenatured form of the protein does not exhibit amyloid fibril formation in vitro. Additionally, Serum Amyloid A-1 serves a crucial role as an apolipoprotein within the HDL complex and demonstrates affinity for heparin binding, underscoring its multifaceted nature in biological processes.

Biological Activity

Measured by its ability to induce TNF-alpha secretion by J774A.1 mouse reticulum cell sarcoma macrophage cells. The ED 50 for this effect is 4.689 μg/mL.

  • Measured by its ability to induce TNF-alpha secretion by J774A.1 mouse reticulum cell sarcoma macrophage cells. The ED50 for this effect is 4.689 μg/mL. Corresponding to a specific activity is 213.265 U/mg.
Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P05366 (G20-Y122)

Gene ID
Molecular Construction
N-term
6*His
SAA1 (G20-Y122)
Accession # P05366
C-term
Synonyms
Serum Amyloid A-1 Protein; SAA; SAA1
AA Sequence

GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY

Molecular Weight

Approximately 13-17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM Tris-HCl,1 mM EDTA, 6% Trehalose, pH 8.0 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 Eu/ug, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SAA1 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SAA1 Protein, Mouse (His)
Cat. No.:
HY-P700309
Quantity:
MCE Japan Authorized Agent: