1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E1 Enzymes
  5. SAE1
  6. SAE1 Protein, Human (GST)

SAE1 protein, forming a heterodimer, acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and potentially SUMO4. It critically mediates ATP-dependent activation of SUMO proteins, enabling the formation of a thioester bond with UBA2/SAE2's active site cysteine. This process is essential for protein modification through sumoylation. SAE1 Protein, Human (GST) is the recombinant human-derived SAE1 protein, expressed by E. coli , with N-GST labeled tag. The total length of SAE1 Protein, Human (GST) is 346 a.a., with molecular weight of ~65.4 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SAE1 protein, forming a heterodimer, acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and potentially SUMO4. It critically mediates ATP-dependent activation of SUMO proteins, enabling the formation of a thioester bond with UBA2/SAE2's active site cysteine. This process is essential for protein modification through sumoylation. SAE1 Protein, Human (GST) is the recombinant human-derived SAE1 protein, expressed by E. coli , with N-GST labeled tag. The total length of SAE1 Protein, Human (GST) is 346 a.a., with molecular weight of ~65.4 kDa.

Background

The SAE1 protein functions as part of a heterodimer, serving as an E1 ligase for SUMO1, SUMO2, SUMO3, and likely SUMO4. It plays a crucial role in mediating ATP-dependent activation of SUMO proteins, facilitating the subsequent formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2. This process is integral to protein modification through sumoylation.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9UBE0 (M1-K346)

Gene ID
Molecular Construction
N-term
GST
SAE1 (M1-K346)
Accession # Q9UBE0
C-term
Synonyms
Activator of SUMO1; AOS1; HSPC140; Sae1; SAE1_HUMAN; Sentrin/SUMO activating protein AOS1; UBL E1A; UBLE1A
AA Sequence

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

Molecular Weight

Approximately 65.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SAE1 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SAE1 Protein, Human (GST)
Cat. No.:
HY-P71643
Quantity:
MCE Japan Authorized Agent: