SARS-CoV-2 S glycoprotein (V483A, HEK293, His)

SARS-CoV-2 S glycoprotein (V483A, HEK 293, His) is a recombinant protein expressed in HEK 293 cells with a His tag. S glycoprotein plays an important role in the evolution and transmission of SARS-CoV-2.

The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry^[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry^[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry^[1][2]. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. The viral pathogen responsible, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), binds to the host receptor through its spike (S) glycoprotein, which mediates membrane fusion and viral entry^[1][2].

Virus

HEK293

C-10*His

P0DTC2 (R319-F541,V483A )

43740568  [NCBI]

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Approximately 27.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Shen S, et al. Expression, glycosylation, and modification of the spike (S) glycoprotein of SARS CoV. Methods Mol Biol. 2007;379:127-135.  [Content Brief]

  [2]. Wang S, et al. AXL is a candidate receptor for SARS-CoV-2 that promotes infection of pulmonary and bronchial epithelial cells. Cell Res. 2021;31(2):126-140.  [Content Brief]