1. Recombinant Proteins
  2. Others
  3. SHH Protein, Human

SHH, Human, as a recombinant protein, is part of a small group of secreted proteins that are vital for development in both vertebrates and invertebrates. SHH, Human, produced in E.Coli, is a single, non-glycosylated polypeptide chain. SHH plays an important role in prostate cancer progression.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

SHH, Human, as a recombinant protein, is part of a small group of secreted proteins that are vital for development in both vertebrates and invertebrates. SHH, Human, produced in E.Coli, is a single, non-glycosylated polypeptide chain. SHH plays an important role in prostate cancer progression.

Background

Sonic hedgehog (SHH) is one of the members of hedgehog gene families. SHH signaling plays a critical role in the embryonic development, including the lung. SHH is important in pattern formation during development. SHH transcription is modulated by a long-range regulatory mechanism containing a number of enhancers[1][2].

Biological Activity

Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is ≤ 0.3049 µg/mL, corresponding to a specific activity is ≥3.279×103 units/mg.

  • Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 0.07853 µg/mL, corresponding to a specific activity is 1.27×104 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q15465 (C24-G197)

Gene ID
Molecular Construction
N-term
SHH (C24-G197)
Accession # Q15465
C-term
Synonyms
Sonic Hedgehog Protein; SHH; HHG-1
AA Sequence

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Weight

Approximately 20 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 100 mM NaCl, 1 mM DTT, pH 7.5 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

SHH Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SHH Protein, Human
Cat. No.:
HY-P70467
Quantity:
MCE Japan Authorized Agent: