Siglec-15 Protein, Cynomolgus (HEK293, His)

Siglec-15 Protein, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis, inhibiting antigen-specific T cell responses in vitro and in vivo. Siglec-15 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Siglec-15 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Siglec-15 Protein, Cynomolgus (HEK293, His) is 244 a.a., with molecular weight of 30-40 kDa.

Siglec-15, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 acts upstream of or within regulation of actin cytoskeleton organization. Siglec-15 deficiency can promote bone formation and reduce bone resorption, indicating that Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis and may serve as a target to inhibit bone resorption and promote bone remodeling that increases bone mass. Siglec-15 is a predominantly macrophage-mediated suppressor of T cell responses. In tumors, Siglec-15 is negatively regulated by IFN-γ, thus influencing effector T cell-mediated antitumor immunity. Genetic ablation or antibody blockade of Siglec-15 amplifies anti-tumor immunity in the TME and inhibits tumor growth in some mouse models. Siglec-15 as a potential target for normalization cancer immunotherapy^[1][2][3][4].

Cynomolgus

HEK293

C-6*His

A0A2K5UY47 (F20-T263)

/

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIINISVLPGPAHAFRALCTAEGEPPPALAWSGPALGNGSAAVPSSGQGHGHLVTAELPALNHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

30-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, 150 mM NaCl, 0.3% Chaps, 5% Trehalose, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.