Siglec-15 Protein, Human (HEK293, Fc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, Fc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-hFc labeled tag.

The Siglec-15 Protein plays a crucial role in cellular interactions by selectively binding to sialylated glycoproteins, indicating a specific affinity for molecules with sialic acid residues. Additionally, Siglec-15 engages in molecular associations with TYROBP and HCST, suggesting its involvement in intricate signaling pathways. This ability to interact with key signaling partners underscores Siglec-15's potential significance in mediating immune responses and cellular communication. The specific recognition of sialylated glycoproteins highlights the protein's role in recognizing and responding to cell surface modifications, contributing to the complex network of cellular interactions.

Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion by Jurkat cells. The ED₅₀ for this effect is 2.166 μg/mL in the presence of 5 μg/mL anti-CD3, corresponding to a specific activity is 461.681 U/mg.

Human

HEK293

C-hFc

Q6ZMC9-1 (F20-T263)

284266  [NCBI]

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Approximately 50-80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 150 mM NaCl, 0.3% Chaps, 5% Trehalose, pH 7.4 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.