SNCG Protein, Human

SNCG proteins help maintain the integrity of neurofilament networks and may influence axonal structure during development and adulthood. In vitro, it enhances the sensitivity of neurofilament-H to calcium-dependent proteases. SNCG Protein, Human is the recombinant human-derived SNCG protein, expressed by E. coli , with tag free. The total length of SNCG Protein, Human is 127 a.a., with molecular weight of 16-18 kDa.

SNCG protein plays a crucial role in maintaining neurofilament network integrity, suggesting involvement in shaping axonal architecture during both developmental stages and adulthood. Additionally, it may contribute to modulating the keratin network in the skin. In vitro studies indicate that SNCG increases the susceptibility of neurofilament-H to calcium-dependent proteases, implying a role in regulating neurofilament dynamics. Furthermore, SNCG activates the MAPK and Elk-1 signal transduction pathway and exhibits potential centrosome association. Its interaction with MYOC influences MYOC secretion and aggregation, highlighting SNCG's diverse involvement in cellular processes with implications for neuronal and skin-related functions.

Human

E. coli

Tag Free

O76070 (M1-D127)

6623  [NCBI]

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

16-18 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.