1. Recombinant Proteins
  2. Others
  3. SP-D Protein, Human (HEK293, His)

The SP-D protein plays a critical role in the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifunctional protein interacts with a variety of compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, to modulate leukocyte activity in immune responses. SP-D Protein, Human (HEK293, His) is the recombinant human-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SP-D Protein, Human (HEK293, His) is 355 a.a., with molecular weight of ~45.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SP-D protein plays a critical role in the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifunctional protein interacts with a variety of compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, to modulate leukocyte activity in immune responses. SP-D Protein, Human (HEK293, His) is the recombinant human-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SP-D Protein, Human (HEK293, His) is 355 a.a., with molecular weight of ~45.0 kDa.

Background

The SP-D protein plays a crucial role in bolstering the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. It engages with various compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, thereby influencing leukocyte activity in the immune response. Additionally, SP-D is implicated in the extracellular reorganization or turnover of pulmonary surfactant, contributing to the maintenance of respiratory function. The protein exhibits a strong binding affinity for maltose residues and, to a lesser extent, other alpha-glucosyl moieties. Notably, SP-D forms an oligomeric complex comprising four sets of homotrimers, emphasizing its structural organization in facilitating its diverse functions (

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH22318.1 (A21-F375)

Gene ID
Molecular Construction
N-term
SP-D (A21-F375)
Accession # AAH22318.1
6*His
C-term
Synonyms
Pulmonary Surfactant-Associated Protein D; PSP-D; SP-D; Collectin-7; Lung Surfactant Protein D; SFTPD; COLEC7; PSPD; SFTP4
AA Sequence

AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

Molecular Weight

Approximately 45.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SP-D Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SP-D Protein, Human (HEK293, His)
Cat. No.:
HY-P70986
Quantity:
MCE Japan Authorized Agent: