SPG21 Protein, Human (sf9, His)

The SPG21 protein may act as a negative regulator in CD4-dependent T cell activation, suggesting its role in regulating immune responses. Its interaction with CD4 suggests a molecular link affecting CD4-mediated T cell activation pathways. SPG21 Protein, Human (sf9, His) is the recombinant human-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.

The SPG21 protein is suggested to potentially function as a negative regulatory factor in CD4-dependent T-cell activation, indicating its involvement in modulating immune responses. It interacts with CD4, suggesting a molecular association that may impact CD4-mediated T-cell activation pathways. Additionally, SPG21 interacts with ALDH16A1, indicating its potential participation in cellular processes associated with the aldehyde dehydrogenase family. The specific mechanisms underlying SPG21's regulatory role in T-cell activation and its interaction with ALDH16A1 remain areas of interest, highlighting its potential significance in immune regulation and cellular metabolism.

Human

Sf9 insect cells

N-6*His

Q9NZD8-1 (M1-Q308)

51324  [NCBI]

MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ

Approximately 35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 150 mM NaCl, pH 8.0, 50% Glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.