1. Recombinant Proteins
  2. Others
  3. STAT3 Protein, Human (His)

STAT3 is a signal transducer and transcriptional activator that coordinates diverse cellular processes in response to growth factors and cytokines such as interleukin-6 and KITLG/SCF. Upon activation, STAT3 recruits coactivators to target gene promoters, thereby affecting proliferation, differentiation, and immune responses. STAT3 Protein, Human (His) is the recombinant human-derived STAT3 protein, expressed by E. coli , with C-6*His labeled tag. The total length of STAT3 Protein, Human (His) is 175 a.a., with molecular weight of 19 & 46 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

STAT3 is a signal transducer and transcriptional activator that coordinates diverse cellular processes in response to growth factors and cytokines such as interleukin-6 and KITLG/SCF. Upon activation, STAT3 recruits coactivators to target gene promoters, thereby affecting proliferation, differentiation, and immune responses. STAT3 Protein, Human (His) is the recombinant human-derived STAT3 protein, expressed by E. coli , with C-6*His labeled tag. The total length of STAT3 Protein, Human (His) is 175 a.a., with molecular weight of 19 & 46 kDa, respectively.

Background

STAT3, a signal transducer and transcription activator, orchestrates cellular responses to various growth factors, interleukins, and cytokines. Upon activation, STAT3 recruits coactivators to the promoter region of target genes, thereby mediating diverse cellular processes such as proliferation, differentiation, and immune response regulation. It responds to signaling from interleukin-6, KITLG/SCF, and other growth factors, facilitating a cascade of downstream events. Additionally, STAT3 plays a role in cell cycle regulation, inflammatory response modulation, and energy homeostasis. Its functions extend to influencing apoptosis, melanocortin production, and insulin secretion. The protein's activation involves homodimerization or heterodimerization with related family members. STAT3 interacts with an array of molecules, including IL31RA, NCOA1, PELP1, SIPAR, SOCS7, STATIP1, and others, contributing to its intricate involvement in cellular signaling pathways.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P40763 (M1-N175)

Gene ID
Molecular Construction
N-term
STAT3 (M1-N175)
Accession # P40763
6*His
C-term
Synonyms
Signal Transducer and Activator of Transcription 3; Acute-Phase Response Factor; STAT3; APRF
AA Sequence

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFN

Molecular Weight

20&45-47 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20mM Tris-HCl, 10% Trehalose, 50mM NaCl, 0.05% Tween 80, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

STAT3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
STAT3 Protein, Human (His)
Cat. No.:
HY-P70574
Quantity:
MCE Japan Authorized Agent: