1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. SULT1C2 Protein, Human (His)

The SULT1C2 protein utilizes PAPS to catalyze sulfate conjugation and has specific affinity for sulfonated p-nitrophenol. It selectively avoids sulfonated steroids, dopamine, acetaminophen or alpha-naphthol. SULT1C2 Protein, Human (His) is the recombinant human-derived SULT1C2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SULT1C2 Protein, Human (His) is 296 a.a., with molecular weight of ~38.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SULT1C2 protein utilizes PAPS to catalyze sulfate conjugation and has specific affinity for sulfonated p-nitrophenol. It selectively avoids sulfonated steroids, dopamine, acetaminophen or alpha-naphthol. SULT1C2 Protein, Human (His) is the recombinant human-derived SULT1C2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SULT1C2 Protein, Human (His) is 296 a.a., with molecular weight of ~38.0 kDa.

Background

SULT1C2 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as its sulfonate donor, plays a pivotal role in catalyzing sulfate conjugation, with a specific affinity for sulfonating p-nitrophenol, a small phenolic compound. Notably, SULT1C2 exhibits selectivity in its substrate preferences, as it does not sulfonate steroids, dopamine, acetaminophen, or alpha-naphthol. Additionally, this sulfotransferase catalyzes the sulfonation of N-Hydroxy-2-acetylaminofluorene, a carcinogenic compound, leading to the formation of highly reactive intermediates capable of generating DNA adducts. This enzymatic activity raises concerns about potential mutagenesis, emphasizing the intricate role of SULT1C2 in the metabolism of xenobiotic compounds and its implications for cellular processes associated with mutagenic risk.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O00338 (M1-L296)

Gene ID
Molecular Construction
N-term
6*His
SULT1C2 (M1-L296)
Accession # O00338
C-term
Synonyms
Sulfotransferase 1C2; ST1C2; Sulfotransferase 1C1; SULT1C#1; humSULTC2; SULT1C2; SULT1C1;
AA Sequence

MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL

Molecular Weight

Approximately 38.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 100 mM NaCl, pH 8.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SULT1C2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SULT1C2 Protein, Human (His)
Cat. No.:
HY-P71012
Quantity:
MCE Japan Authorized Agent: