1. Recombinant Proteins
  2. Others
  3. SWSAP1 Protein, Human (His)

SWSAP1, an ATPase selectively activated by single-stranded DNA, is vital for homologous recombination repair (HRR). In addition to ATPase activity, SWSAP1 independently binds DNA. Teaming up with ZSWIM7, it forms a complex crucial for HRR, with mutual stabilization. SWSAP1 interacts with key HRR proteins—RAD51, RAD51B, RAD51C, RAD51D, and XRCC3—underscoring its role in facilitating homologous recombination repair processes. SWSAP1 Protein, Human (His) is the recombinant human-derived SWSAP1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SWSAP1 Protein, Human (His) is 229 a.a., with molecular weight of ~30.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SWSAP1, an ATPase selectively activated by single-stranded DNA, is vital for homologous recombination repair (HRR). In addition to ATPase activity, SWSAP1 independently binds DNA. Teaming up with ZSWIM7, it forms a complex crucial for HRR, with mutual stabilization. SWSAP1 interacts with key HRR proteins—RAD51, RAD51B, RAD51C, RAD51D, and XRCC3—underscoring its role in facilitating homologous recombination repair processes. SWSAP1 Protein, Human (His) is the recombinant human-derived SWSAP1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SWSAP1 Protein, Human (His) is 229 a.a., with molecular weight of ~30.0 kDa.

Background

The ATPase SWSAP1 is selectively stimulated by single-stranded DNA and plays a crucial role in homologous recombination repair (HRR). Apart from its ATPase activity, SWSAP1 exhibits an independent DNA-binding capability. It forms a functional complex with ZSWIM7, contributing to homologous recombination repair, and both proteins mutually stabilize each other. SWSAP1 further interacts with key proteins involved in HRR, including RAD51, RAD51B, RAD51C, RAD51D, and XRCC3, highlighting its involvement in facilitating homologous recombination repair processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q6NVH7 (M1-P229)

Gene ID

126074  [NCBI]

Molecular Construction
N-term
6*His
SWSAP1 (M1-P229)
Accession # Q6NVH7
C-term
Synonyms
ATPase SWSAP1; SWIM-type zinc finger 7-associated protein 1; SWS1-associated protein 1; ZSWIM7-associated protein 1; SWSAP1; C19orf39
AA Sequence

MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP

Molecular Weight

Approximately 30.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, 1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SWSAP1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SWSAP1 Protein, Human (His)
Cat. No.:
HY-P71347
Quantity:
MCE Japan Authorized Agent: