1. Recombinant Proteins
  2. Others
  3. Synaptotagmin VI Protein, Human (N-His)

Synaptotagmin VI Protein, Human (N-His)

Cat. No.: HY-P74533A
SDS COA Handling Instructions

Ptk7 Protein is a receptor that is involved in various cellular processes, including cell proliferation and migration. It plays a crucial role in regulating embryonic development and tissue homeostasis. Dysregulation of Ptk7 Protein has been associated with various diseases, including cancer and developmental disorders. Targeting Ptk7 Protein may offer potential therapeutic interventions in these conditions by inhibiting cell proliferation and migration, and promoting tissue homeostasis. Synaptotagmin VI Protein, Human (N-His) is the recombinant human-derived Synaptotagmin VI protein, expressed by E. coli, with N-His labeled tag. The total length of Synaptotagmin VI Protein, Human (N-His) is 151 a.a., with molecular weight of ~19 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $55 In-stock
10 μg $95 In-stock
50 μg $265 In-stock
100 μg $450 In-stock
500 μg $1350 In-stock
1 mg $2200 In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ptk7 Protein is a receptor that is involved in various cellular processes, including cell proliferation and migration. It plays a crucial role in regulating embryonic development and tissue homeostasis. Dysregulation of Ptk7 Protein has been associated with various diseases, including cancer and developmental disorders. Targeting Ptk7 Protein may offer potential therapeutic interventions in these conditions by inhibiting cell proliferation and migration, and promoting tissue homeostasis. Synaptotagmin VI Protein, Human (N-His) is the recombinant human-derived Synaptotagmin VI protein, expressed by E. coli, with N-His labeled tag. The total length of Synaptotagmin VI Protein, Human (N-His) is 151 a.a., with molecular weight of ~19 kDa.

Background

Synaptotagmin VI protein, a member of the synaptotagmin family, possesses a common domain structure comprising a transmembrane domain and a cytoplasmic region consisting of 2 C2 domains. These proteins play a vital role in calcium-dependent exocytosis of synaptic vesicles. Specifically, synaptotagmin VI is a crucial component of the secretory machinery involved in acrosomal exocytosis. This gene exhibits alternatively spliced transcript variants. Furthermore, it demonstrates biased expression in specific tissues, including the brain (RPKM 2.6), kidney (RPKM 0.8), and 6 other tissues.

Species

Human

Source

E. coli

Tag

N-His

Accession

NP_995320 (V275-L425)

Gene ID

148281

Molecular Construction
N-term
His
Synaptotagmin VI (V275-L425)
Accession # NP_995320
C-term
Synonyms
Synaptotagmin-6; Synaptotagmin VI; SytVI; SYT6
AA Sequence

VDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGITAEGLGRDHWNEMLAYPRKPIAHWHSLVEVKKSFKEGNPRL

Molecular Weight

Approximately 19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Synaptotagmin VI Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Synaptotagmin VI Protein, Human (N-His)
Cat. No.:
HY-P74533A
Quantity:
MCE Japan Authorized Agent: