1. Recombinant Proteins
  2. Others
  3. SYNGAP1 Protein, Human (His)

SYNGAP1 protein is a major postsynaptic density component that plays a critical regulatory role in the Ras-cAMP pathway, affecting synaptic function and plasticity. At excitatory synapses, it is part of the NMDAR signaling complex and may influence NMDAR-dependent control of AMPAR potentiation, trafficking, and synaptic plasticity. SYNGAP1 Protein, Human (His) is the recombinant human-derived SYNGAP1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SYNGAP1 protein is a major postsynaptic density component that plays a critical regulatory role in the Ras-cAMP pathway, affecting synaptic function and plasticity. At excitatory synapses, it is part of the NMDAR signaling complex and may influence NMDAR-dependent control of AMPAR potentiation, trafficking, and synaptic plasticity. SYNGAP1 Protein, Human (His) is the recombinant human-derived SYNGAP1 protein, expressed by E. coli , with N-His labeled tag.

Background

SYNGAP1 Protein takes center stage as a major constituent of the postsynaptic density (PSD), playing a crucial role in postsynaptic signaling. Functioning as an inhibitory regulator of the Ras-cAMP pathway, SYNGAP1 is integral to synaptic function and plasticity. Within the excitatory synapses, it serves as a member of the NMDAR signaling complex, potentially influencing NMDAR-dependent control of AMPAR potentiation, AMPAR membrane trafficking, and overall synaptic plasticity. Furthermore, SYNGAP1 regulates AMPAR-mediated miniature excitatory postsynaptic currents and exhibits dual GTPase-activating specificity for both Ras and Rap. Interactions with KLHL17, CAMK2A, CAMK2B, and MPDZ highlight its intricate network within synaptic signaling pathways. Notably, it may be implicated in certain forms of brain injury, leading to long-term deficits in learning and memory, underscoring its critical role in neural function.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q96PV0 (1161M-1343H)

Gene ID
Molecular Construction
N-term
His
SYNGAP1 (1161M-1343H)
Accession # Q96PV0
C-term
Synonyms
DKFZp761G1421 ; KIAA1938; MRD5; Neuronal RasGAP; OTTHUMP00000064825; p135 SynGAP; Ras GTPase activating protein SynGAP; Synaptic Ras-GAP 1; SYNGAP 1; SYNGAP1
AA Sequence

MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH

Molecular Weight

Approximately 28 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SYNGAP1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SYNGAP1 Protein, Human (His)
Cat. No.:
HY-P71619
Quantity:
MCE Japan Authorized Agent: