Syntenin-1 Protein, Human (C-His)

Syntenin-1 is a multifunctional adapter protein that coordinates multiple cellular processes, including transmembrane protein trafficking, neural and immune regulation, exosome biogenesis, and tumorigenesis. It actively regulates TGFB1 signaling and enhances SMAD2/3 activation, TGFB1-induced epithelial-mesenchymal transition (EMT), and cell migration. Syntenin-1 Protein, Human (C-His) is the recombinant human-derived Syntenin-1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of Syntenin-1 Protein, Human (C-His) is 297 a.a., with molecular weight of ~ 32.0 kDa.

Syntenin-1, a multifunctional adapter protein, is intricately involved in a diverse array of cellular processes, encompassing the trafficking of transmembrane proteins, neuro and immunomodulation, exosome biogenesis, and tumorigenesis. In various cell types, it exerts a positive regulatory influence on TGFB1-mediated SMAD2/3 activation, TGFB1-induced epithelial-to-mesenchymal transition (EMT), and cell migration. This multifaceted protein enhances TGFB1 signaling by augmenting cell-surface expression of TGFR1, preventing its interaction with CAV1 and subsequent CAV1-dependent internalization and degradation of TGFR1. Syntenin-1, in collaboration with SDC1/4 and PDCD6IP, plays a pivotal role in exosome biogenesis. Its regulatory impact extends to cancer biology, where it modulates migration, growth, proliferation, and cell cycle progression across various cancer types. In adherens junctions, Syntenin-1 may function to couple syndecans to cytoskeletal proteins or signaling components and is implicated in linking the transcription factor SOX4 to the IL-5 receptor (IL5RA). Furthermore, it appears to be crucial for the targeting of TGFA to the cell surface in the early secretory pathway. Syntenin-1 exists both as a monomer and homodimer, interacting with a spectrum of proteins, including SDC1-4, NRXN2, EPHA7, EPHB1, NF2 isoform 1, TGFA, IL5RA, NFASC, PTPRJ, SDCBP2, and TGFBR1, forming complexes that contribute to its versatile functional repertoire. Additionally, its interaction with FZD7 is modulated by inositol trisphosphate (IP3), and it forms an interaction with SMO, further highlighting its intricate involvement in various cellular pathways.

Human

E. coli

C-6*His

O00560 (S2-V298)

6386  [NCBI]

SLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV

Approximately 32.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Acetate, 250 mM Mannitol, 0.05% Tween 80, pH 4.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.