1. Recombinant Proteins
  2. Others
  3. Syntenin-1 Protein, Human (C-His)

Syntenin-1 is a multifunctional adapter protein that coordinates multiple cellular processes, including transmembrane protein trafficking, neural and immune regulation, exosome biogenesis, and tumorigenesis. It actively regulates TGFB1 signaling and enhances SMAD2/3 activation, TGFB1-induced epithelial-mesenchymal transition (EMT), and cell migration. Syntenin-1 Protein, Human (C-His) is the recombinant human-derived Syntenin-1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of Syntenin-1 Protein, Human (C-His) is 297 a.a., with molecular weight of ~ 32.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Syntenin-1 is a multifunctional adapter protein that coordinates multiple cellular processes, including transmembrane protein trafficking, neural and immune regulation, exosome biogenesis, and tumorigenesis. It actively regulates TGFB1 signaling and enhances SMAD2/3 activation, TGFB1-induced epithelial-mesenchymal transition (EMT), and cell migration. Syntenin-1 Protein, Human (C-His) is the recombinant human-derived Syntenin-1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of Syntenin-1 Protein, Human (C-His) is 297 a.a., with molecular weight of ~ 32.0 kDa.

Background

Syntenin-1, a multifunctional adapter protein, is intricately involved in a diverse array of cellular processes, encompassing the trafficking of transmembrane proteins, neuro and immunomodulation, exosome biogenesis, and tumorigenesis. In various cell types, it exerts a positive regulatory influence on TGFB1-mediated SMAD2/3 activation, TGFB1-induced epithelial-to-mesenchymal transition (EMT), and cell migration. This multifaceted protein enhances TGFB1 signaling by augmenting cell-surface expression of TGFR1, preventing its interaction with CAV1 and subsequent CAV1-dependent internalization and degradation of TGFR1. Syntenin-1, in collaboration with SDC1/4 and PDCD6IP, plays a pivotal role in exosome biogenesis. Its regulatory impact extends to cancer biology, where it modulates migration, growth, proliferation, and cell cycle progression across various cancer types. In adherens junctions, Syntenin-1 may function to couple syndecans to cytoskeletal proteins or signaling components and is implicated in linking the transcription factor SOX4 to the IL-5 receptor (IL5RA). Furthermore, it appears to be crucial for the targeting of TGFA to the cell surface in the early secretory pathway. Syntenin-1 exists both as a monomer and homodimer, interacting with a spectrum of proteins, including SDC1-4, NRXN2, EPHA7, EPHB1, NF2 isoform 1, TGFA, IL5RA, NFASC, PTPRJ, SDCBP2, and TGFBR1, forming complexes that contribute to its versatile functional repertoire. Additionally, its interaction with FZD7 is modulated by inositol trisphosphate (IP3), and it forms an interaction with SMO, further highlighting its intricate involvement in various cellular pathways.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O00560 (S2-V298)

Gene ID
Molecular Construction
N-term
Syntenin-1 (S2-V298)
Accession # O00560
6*His
C-term
Synonyms
Syntenin-1; Melanoma differentiation-associated protein 9; Pro-TGF-alpha cytoplasmic domain-interacting protein 18; Scaffold protein Pbp1; Syndecan-binding protein 1; SDCBP; MDA9; SYCL;
AA Sequence

SLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV

Molecular Weight

Approximately 32.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Acetate, 250 mM Mannitol, 0.05% Tween 80, pH 4.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Syntenin-1 Protein, Human (C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Syntenin-1 Protein, Human (C-His)
Cat. No.:
HY-P71014
Quantity:
MCE Japan Authorized Agent: