1. Recombinant Proteins
  2. Others
  3. TAFA2/FAM19A2 Protein, Human

The FAM19A2 protein plays a key role as a neurotrophic factor, actively promoting neuronal survival and various neurobiological functions. Its involvement is shown to have a critical impact on the maintenance and health of neurons, underscoring its potential significance in supporting neurological health. TAFA2/FAM19A2 Protein, Human is the recombinant human-derived TAFA2/FAM19A2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FAM19A2 protein plays a key role as a neurotrophic factor, actively promoting neuronal survival and various neurobiological functions. Its involvement is shown to have a critical impact on the maintenance and health of neurons, underscoring its potential significance in supporting neurological health. TAFA2/FAM19A2 Protein, Human is the recombinant human-derived TAFA2/FAM19A2 protein, expressed by E. coli , with tag free.

Background

The FAM19A2 protein functions as a neurotrophic factor, playing a critical role in promoting neuronal survival and contributing to various neurobiological functions. Its involvement in supporting the well-being and persistence of neurons underscores its significance in maintaining proper neuronal health. The characterization of FAM19A2 as a neurotrophic factor suggests its potential relevance in neuroprotective strategies and the modulation of essential processes within the nervous system.

Biological Activity

1. The biological activity is determined by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. rHuTAFA-2; immobilized at 6-24 μg/mL on a 96 well plate; is able to significantly enhance neurite outgrowth.
2. Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED50 this effect is 1.455-3.659 μg/mL, corresponding to a specific activity is > 273.30 units/mg.

  • Measured in a cell proliferation assay using SH-SY5Y human neuroblastoma cells. The ED50 for this effect is 3.659 μg/ml, corresponding to a specific activity is 273.30 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q8N3H0-1 (A31-H131)

Gene ID
Molecular Construction
N-term
TAFA2 (A31-H131)
Accession # Q8N3H0-1
C-term
Synonyms
Chemokine-like protein TAFA-2; TAFA-2; FAM19A2
AA Sequence

ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH

Molecular Weight

11-15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 2 × PBS, pH 7.4 or 40 mM PB, 300 mM NaCl, pH 6.8.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TAFA2/FAM19A2 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TAFA2/FAM19A2 Protein, Human
Cat. No.:
HY-P72777
Quantity:
MCE Japan Authorized Agent: