Thioredoxin/TRX Protein, Mouse (N-His)

Thioredoxin/TRX proteins participate in multiple redox reactions, utilizing their reactive dithiol centers for reversible oxidation and disulfide bond formation.It catalyzes important dithiol-disulfide exchange and plays a key role in S-nitrosylation of cysteine residues in response to intracellular nitric oxide.Thioredoxin/TRX Protein, Mouse (N-His) is the recombinant mouse-derived Thioredoxin/TRX protein, expressed by E.coli , with N-6*His labeled tag.

Thioredoxin/TRX Protein is actively involved in diverse redox reactions, utilizing its active center dithiol to undergo reversible oxidation and disulfide formation, thereby catalyzing essential dithiol-disulfide exchange reactions. Beyond its classical redox functions, Thioredoxin plays a crucial role in the reversible S-nitrosylation of cysteine residues within target proteins, contributing to the cellular response to intracellular nitric oxide. Notably, it nitrosylates the active site cysteine of CASP3 in response to nitric oxide, effectively inhibiting caspase-3 activity. Moreover, Thioredoxin demonstrates regulatory influence over the FOS/JUN AP-1 DNA binding activity in ionizing radiation cells, modulating AP-1 transcriptional activity through its redox state. Additionally, Thioredoxin is implicated in the augmentation of interleukin-2 receptor TAC (IL2R/P55) expression, underscoring its multifaceted role in cellular processes beyond redox regulation.

Measured by its ability to catalyze the reduction of insulin. The reaction leads to precipitation, which can be measured by absorbance at 650 nm. The specific activity is 5.603 A650/min/mg, as measured under the described conditions.

Mouse

E. coli

N-6*His

P10639 (M1-A105)

22166  [NCBI]

MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVDDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA

Approximately 15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.