1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Stem Cell CD Proteins Endothelial cell CD Proteins
  4. Thy-1/CD90
  5. Thy1/CD90 Protein, Cynomolgus (HEK293, His)

Thy1/CD90 Protein is a member of the immunoglobulin family. It plays a role in cell adhesion and cell communication in many cell types, especially in cells of the immune and nervous systems.Thy1/CD90 protein has multiple immune functions and also participates in the regulation of cell-cell and cell-matrix interactions in axonal regeneration, apoptosis, adhesion, migration, cancer, and fibrosis. Thy1/CD90 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag. The total length of Thy1/CD90 Protein, Cynomolgus (HEK293, His) is 110 a.a., with molecular weight of 27-32 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Thy1/CD90 Protein is a member of the immunoglobulin family. It plays a role in cell adhesion and cell communication in many cell types, especially in cells of the immune and nervous systems.Thy1/CD90 protein has multiple immune functions and also participates in the regulation of cell-cell and cell-matrix interactions in axonal regeneration, apoptosis, adhesion, migration, cancer, and fibrosis. Thy1/CD90 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag. The total length of Thy1/CD90 Protein, Cynomolgus (HEK293, His) is 110 a.a., with molecular weight of 27-32 kDa.

Background

Thy1/CD90 Protein has multiple immune functions. Most of them are mediated through interactions with integrins[1][2].
Thy1/CD90 Protein is an activation determinant. The binding and cross-linking of Thy1/CD90 Protein on the surface of T cells by MAb may lead to T cell activation in a manner similar to that of plant lectins, resulting in the production of polyclonal interleukin-2 (IL-2), expression of IL-2R, and proliferation[3].
Thy1/CD90 protein acts as a regulator of cell-cell and cell-matrix interactions in axonal regeneration, apoptosis, adhesion, migration, cancer, and fibrosis. It also affects many non-immune biological processes[4].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus CD90 is immobilized at 5.00 µg/mL (100 µL/well), recombinant Human Galectin-1 binds with an ED50 of 0.4373 μg/mL.

Species

Cynomolgus

Source

HEK293

Tag

C-His

Accession

A0A2K5U4H6 (Q20-K129)

Gene ID
Molecular Construction
N-term
Thy1 (Q20-K129)
Accession # A0A2K5U4H6
His
C-term
Synonyms
Thy-1 membrane glycoprotein; Thy-1 antigen; CD90; Thy-1
AA Sequence

QKVTSLTACLVDQSLRLDCRHENTTSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVK

Molecular Weight

Approximately 27 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thy1/CD90 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P76105
Quantity:
MCE Japan Authorized Agent: