Thy1/CD90 Protein, Mouse (HEK293, His)

Thy1/CD90 protein may play a role in cell-cell interactions, especially during synaptogenesis in the brain. It facilitates communication and connections between cells, shaping neural network architecture and functionality. Understanding how Thy1/CD90 participates in these interactions can provide insights into its role in brain function and connectivity. Thy1/CD90 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag. The total length of Thy1/CD90 Protein, Mouse (HEK293, His) is 112 a.a., with molecular weight of 17-27 kDa.

The Thy1/CD90 protein emerges as a potential player in cell-cell or cell-ligand interactions, particularly during crucial events such as synaptogenesis in the brain. This implies a role for Thy1/CD90 in facilitating communication and connections between cells, contributing to the intricate processes involved in the formation and organization of synapses. The specific involvement of Thy1/CD90 in these interactions highlights its potential significance in shaping the architecture and functionality of neural networks. Further exploration into the precise mechanisms by which Thy1/CD90 participates in cell-cell or cell-ligand interactions during various neurodevelopmental events could provide valuable insights into its role in brain function and connectivity.

Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD90/Thy-1 is immobilized at 5.00 µg/mL (100 µL/well), Recombinant Mouse Galectin-1 binds with an ED₅₀ of 0.203 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD90/Thy-1 is immobilized at 5.00 µg/mL (100 µL/well), Recombinant Mouse Galectin-1 binds with an ED₅₀ of 0.203 μg/mL.

Mouse

HEK293

C-His

P01831 (Q20-C131)

21838  [NCBI]

QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC

The protein migrates as approximately 17-27 kDa under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.