TIM-1/KIM-1/HAVCR Protein, Canine (HEK293, His)

TIM-1/KIM-1/HAVCR Protein, Canine (HEK293, His) is the recombinant canine-derived TIM-1/KIM-1/HAVCR, expressed by HEK293 , with N-His labeled tag. ,

Canine

HEK293

N-His

NP_001192043/XP_854888.1 (Y21-S160)

612069  [NCBI]

YVQVNGVVGHPATLPCTYSTASGVTTMCWGRGACPISHCLEEIVWTNGSHVTFQKHLRYKLKGKLSEGDVSLTIENAAQTDSGQYCCRVEHRGWFNDMKLTLSLEIKPDGNGTVTQSSDGLWHNNQTHVSLAQNSWMTTS

Approximately 32-40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE. It migrates as an approximately 32-40 kDa band in SDS-PAGE under reducing conditions due to glycosylation.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.