TIM-1/KIM-1/HAVCR Protein, Rat (HEK293, His)

TIM-1/KIM-1/HAVCR protein is a phosphatidylserine receptor that plays a crucial regulatory role in regulatory B cells, affecting their generation, expansion and inhibitory functions. It acts as a ligand for P-selectin/SELPLG and controls activated T cell trafficking during inflammatory responses. TIM-1/KIM-1/HAVCR Protein, Rat (HEK293, His) is the recombinant rat-derived TIM-1/KIM-1/HAVCR protein, expressed by HEK293 , with N-His labeled tag. The total length of TIM-1/KIM-1/HAVCR Protein, Rat (HEK293, His) is 221 a.a., with molecular weight of ~55-65 kDa.

TIM-1/KIM-1/HAVCR Protein serves as a phosphatidylserine receptor with a crucial functional role in the homeostasis of regulatory B-cells, influencing their generation, expansion, and suppressor functions. Additionally, as a ligand for P-selectin/SELPLG, it assumes a specialized role in the trafficking of activated T-cells during inflammatory responses, particularly controlling T-cell accumulation in the inflamed central nervous system and influencing the induction of autoimmune disease. TIM-1/KIM-1/HAVCR also regulates the expression of various anti-inflammatory cytokines and co-inhibitory ligands, including IL10, acting as a modulator of T-cell proliferation. Furthermore, it may play a role in kidney injury and repair. Interactions with STAM and SELPLG contribute to the multifaceted regulatory functions of TIM-1/KIM-1/HAVCR Protein.

Rat

HEK293

N-His

O54947/NP_775172.1 (S18-V238)

286934  [NCBI]

SVDSYEVVKGVVGHPVTIPCTYSTRGGITTTCWGRGQCPYSSCQNILIWTNGYQVTYRSSGRYNIKGRISEGDVSLTIENSVDSDSGLYCCRVEIPGWFNDQKMTFSLEVKPEIPTSPPTRPTTTRPTTTRPTTISTRSTHVPTSTRVSTSTPTPEQTQTHKPEITTFYAHETTAEVTETPSYTPADWNGTVTSSEEAWNNHTVRIPLRKPQRNPTKGFYV

Approximately 55-65 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE. It migrates as an approximately 55-65 kDa band in SDS-PAGE under reducing conditions due to glycosylation.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.