1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Tissue Inhibitor of Metalloproteinase (TIMPs)
  5. TIMP-1
  6. TIMP-1 Protein, Human (HEK293, His)

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

TIMP-1, a metalloproteinase inhibitor, operates through the formation of one-to-one complexes with target metalloproteinases, including collagenases, leading to their irreversible inactivation by binding to the catalytic zinc cofactor. Its inhibitory spectrum encompasses MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13, and MMP16, excluding MMP14. Beyond its role as an enzyme inhibitor, TIMP-1 functions as a growth factor, orchestrating cell differentiation, migration, and cell death while activating intricate cellular signaling cascades through interactions with CD63 and ITGB1. This multifaceted protein also plays a crucial role in integrin signaling and, notably, mediates erythropoiesis in vitro, exhibiting species-specific stimulation of human and murine erythroid progenitors, distinct from IL3. Moreover, TIMP-1 engages in protein-protein interactions with MMP1, MMP3, MMP10, and MMP13, demonstrating its regulatory influence on these metalloproteinases. It forms a complex with CD63 and ITGB1, further emphasizing its involvement in complex cellular signaling networks.

Biological Activity

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 this effect is 19.88 ng/mL, corresponding to a specific activity is 5.03×104 units/mg.

  • Measured in a cell proliferation assay using NIH‑3T3 mouse fibroblast cells. The ED50 this effect is 19.88 ng/mL, corresponding to a specific activity is 5.03×104 units/mg.
Species

Human

Source

HEK293

Tag

C-His

Accession

P01033 (C24-A207)

Gene ID
Molecular Construction
N-term
TIMP-1 (C24-A207)
Accession # P01033
His
C-term
Synonyms
Metalloproteinase Inhibitor 1; Erythroid-Potentiating Activity; EPA; Fibroblast collagenase Inhibitor; Collagenase Inhibitor; Tissue Inhibitor of Metalloproteinases 1; TIMP-1; TIMP1; CLGI; TIMP
AA Sequence

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Molecular Weight

Approximately 27.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TIMP-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIMP-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71055
Quantity:
MCE Japan Authorized Agent: