2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Hydrolases (EC 3)
  5. Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO)

Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO)

Cat. No.: HY-P71621
Handling Instructions

Tissue alpha-L-Fucosidase Proteinas, an enzymatic entity, crucially hydrolyzes alpha-1,6-linked fucose residues on glycoproteins' carbohydrate moieties. Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO) is the recombinant mouse-derived Tissue alpha-L-Fucosidase protein, expressed by E. coli, with N-His, N-SUMO labeled tag. The total length of Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO) is 435 a.a., with molecular weight of ~66.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Tissue alpha-L-Fucosidase Proteinas, an enzymatic entity, crucially hydrolyzes alpha-1,6-linked fucose residues on glycoproteins' carbohydrate moieties. Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO) is the recombinant mouse-derived Tissue alpha-L-Fucosidase protein, expressed by E. coli, with N-His, N-SUMO labeled tag. The total length of Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO) is 435 a.a., with molecular weight of ~66.6 kDa.
Background

Tissue alpha-L-fucosidase, as an enzymatic entity, plays a crucial role in the hydrolysis of alpha-1,6-linked fucose residues attached to the reducing-end N-acetylglucosamine within the carbohydrate moieties of glycoproteins.
Species

Mouse
Source

E. coli
Tag

N-His;N-SUMO
Accession

Q99LJ1 (18L-452N)
Gene ID
Molecular Construction
N-term
6*His-SUMO
FUCA1 (18L-452N)
Accession # Q99LJ1
C-term
Synonyms
Fuca1; FucaTissue alpha-L-fucosidase; EC 3.2.1.51; Alpha-L-fucosidase I; Alpha-L-fucoside fucohydrolase 1; Alpha-L-fucosidase 1
AA Sequence

LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN

Molecular Weight

Approximately 66.6 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO)
Cat. No.:
HY-P71621
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (0 KB) Français - FR (0 KB) Deutsch - DE (0 KB) Norwegian - NO (0 KB) Español - ES (0 KB) Swedish - SV (0 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.